SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007190 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007190
Domain Number 1 Region: 253-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-80
Family Protein kinases, catalytic subunit 0.0000000155
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 1.24e-33
Family SH2 domain 0.0000334
Further Details:      
 
Domain Number 3 Region: 63-139
Classification Level Classification E-value
Superfamily SH3-domain 8.16e-17
Family SH3-domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007190   Gene: ENSDORG00000007673   Transcript: ENSDORT00000007673
Sequence length 527
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_606:5542:63265:-1 gene:ENSDORG00000007673 transcript:ENSDORT00000007673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILSTXXXXXXXXXXXXXXXXXXXRVRTQISLSKDEELSEKYTPPRRWWCGGLSSKKQCS
RDCVQPSQRKPLPPLPPSELTKEKIWVKALYDFLPREPCNLALKRAEEYLVLEKYDPHWW
KARDCCGNEGLIPSNYVTENKLTNLEIYEWYHRNITRNQAEHLLRQQAKEGAFIVRDSRH
LGSYTISVFIKARRNTEATIKHYQIKRNDAGQWYVAERHPFPSIPELIRYHQLNAAGLIS
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFVKELGRGQFGIVHLGEWRAHTQVAIKA
IREGSMSEEDFIEEAKVMTKLSHSRLVQLYGVCIQQKPLYIVTEFMKNGCLLNYLKERKG
KLRRETLLSVCQDICEGMEYLEKSCYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
ISSSGAKFPIRWSPPEVLHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
SGFRLYRPYLAPMSIYKVMYSCWHENPEGRPTFAELLQVLAEIAETW
Download sequence
Identical sequences ENSDORP00000007190 ENSDORP00000007190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]