SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007640 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007640
Domain Number 1 Region: 424-575
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-25
Family SPRY domain 0.011
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 8.17e-17
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 174-233
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000336
Family B-box zinc-binding domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007640   Gene: ENSDORG00000008144   Transcript: ENSDORT00000008144
Sequence length 642
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2764:147627:153175:-1 gene:ENSDORG00000008144 transcript:ENSDORT00000008144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRSAGGTGGPGGAARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGAGPGPMSSPTSGPARSPTPEPSAPSAPPLAPEPSAPCA
PEPWATGEEPVRCDACPEGAARPAARSCLSCLASFCAAHLGPHERSPALRGHRLVPPLRR
LEESLCPRHLRPLERFCRAERLCLCQACAAQEHRGHELVPLEQERALQEAEQPKVLSAVD
DRMDELGASIAQSRRTVALIKSAAVAERERVSQLFAEAAAALQGFQTELLGFIKEGESAL
LSRSQGDLWRQEEQRSRLSRARHNLSQVPEADSVSFLQEFLALRLALEEGCGPGPGPPRE
LSFTKSSQAVRAVRDALVSACGSQWEQLRGLGGDADGLQKLGPEADVESQDADSTNLLDS
EAPRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHCEQVLGEGA
LDRGTYYWEVEIIEGWVSVGVMAEGFSPQEPYDRGRLGRNGHSCCLQWNGRGFSVWFHGL
EATLPHAFSPTVGVCLEYADRALAFYAVRDGKLSLLRRLKASRPRRSGALASPADPFQSR
LDSHFGELFNHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences ENSDORP00000007640 ENSDORP00000007640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]