SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Dipodomys ordii 69_1 > ENSDORP00000007652

Domain assignment for ENSDORP00000007652 from Dipodomys ordii 69_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSDORP00000007652
Domain Number 1 Region: 84-145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000419
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 924-985
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000262
Family Complement control module/SCR domain 0.00016
Further Details:      
 
Domain Number 3 Region: 680-745
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000293
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 982-1043
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000157
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 260-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000511
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 6 Region: 560-622
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000055
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 7 Region: 868-926
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000122
Family Complement control module/SCR domain 0.0002
Further Details:      
 
Domain Number 8 Region: 208-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000256
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 9 Region: 23-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000076
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 10 Region: 809-864
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000865
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 11 Region: 387-443
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000124
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 12 Region: 506-570
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000027
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007652
Domain Number - Region: 316-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000642
Family Complement control module/SCR domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007652   Gene: ENSDORG00000008157   Transcript: ENSDORT00000008157
Sequence length 1044
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4539:289468:333516:1 gene:ENSDORG00000008157 transcript:ENSDORT00000008157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
RTPAEIVWFILWAVCVAQDCQGPPPKKTTEVLSGSWPEQTYPEGKQAVYKCRPGYRTLGT
IQMVCRSGEWVSVNPNRVCRKRPCGHPGDMPFGSFQLTVGSEFEFGARVVYTCDEGYQLI
GETNFRDCEADGWSNDVPTCETVKCLPLTEPKNXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXISCTLPEIQNGYPLSTGRIFKENERFQYKCHPGFD
YTERGDAVCTASGWNPQPSCEETTCKPPYIPNGVYSPHRIKHRTEDEVRYQCNDGFYPST
RANVVKCTSTGWVPAPRCILKPCDFPKINHGNLYDKERYKPYFPVPIGSSFNYFCDRGFV
ASPSHSYWNSISCTAEGWTPEVPCLKQCELHYVENGRYSHGRLYVQGQSVKVECNTGFSL
PNGLNMVTCTEDNWKPPLKCIRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXSCDKPVFEHASSKNNASWFKLNDKLDYECHVGYEN
KHKKVKGSIECKHDGWSDTPSCFERECKIPKMEKYLIAEPRKEKYKVGDVLKFSCRPRRT
RVGPDSVQCYHFGWSPRVPVCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXQRKIQCDDGKWTPVCIEEHRTCGDIPQLDHGYAQSWEPGAPYRHGDTVEFQCL
EAFTMVGPKSITCMSGAWTQLPQCVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXIERGWCPPPPQIPKAQPMETTVKYQDGEKLSVLCL
ENYLSQEGGEMLCQDGRWQALPRCVEKIGCFQPPSIDYGTIQSPRLLEEIYKHGTKFNYI
CDDGFQLSAEDGTRCHLGKWSPPPQCVGLPCVSPPSIENGVVSHHADSYQYQEEVSYNCS
EGFGFDGSSFIKCIGGKWSTPPRCIRTDCFDVPRVDVAKLIGQKKAVYKSGEQLTYECPP
FYQLNGSNTVTCVNGKWIGMPTCK
Download sequence
Identical sequences ENSDORP00000007652 ENSDORP00000007652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.