SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008158 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008158
Domain Number 1 Region: 666-924
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-59
Family Protein kinases, catalytic subunit 0.0000000691
Further Details:      
 
Domain Number 2 Region: 54-229
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.83e-46
Family Ephrin receptor ligand binding domain 0.0000224
Further Details:      
 
Domain Number 3 Region: 369-580
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-32
Family Fibronectin type III 0.0000574
Further Details:      
 
Domain Number 4 Region: 946-1018
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.68e-17
Family SAM (sterile alpha motif) domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008158
Domain Number - Region: 299-372,408-414
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000879
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008158   Gene: ENSDORG00000008691   Transcript: ENSDORT00000008690
Sequence length 1020
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6636:117038:125293:1 gene:ENSDORG00000008691 transcript:ENSDORT00000008690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEGTIQSGNRVAGMVYSLWILVLGPSVLALEXXXXXXXXXXXXXXXXXXXXXXWDEVS
VLDDQRRLTRTFEACHVAGAPPGTAQDNWLQTHFVERRGAQRVHIRLHFSVRACSSLGVS
GGACRETFTLYYRQAEEPDSLDSVSAWHLKRWTKVDTIAADESFPASSSSFTSSSSSSTW
TVGPHRTHQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVKLFSYTCPTVLRAF
ASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGC
RCQPGHQPVRGDKICQACPRGSYKALAGNAPCSPCPIRSHAPDPAAPVCPCLQGFYRASS
DPPEAPCTGPPSAPRELWFEVQGSALMLHWRLPQELGGRGDLLFNVVCKECGDHPEGGGG
ATCRRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINV
STSHEVPSAVPVVHQVSRAASSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSE
TNTATVTRLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIREL
AREVDPAYIKIEEVIGAGSFGEVRRGRLQPRGRREQAVAIQALWAGGAESLQMTFLGRAA
LLGQFQHPNILRLEGVVTKSRPLMVLTELMELGPLDSFLRQREGQFSSLQLVAMQRGVAA
AMQYLSSFAFVHRALSAQSVLVNSHLVCKVARLGYHPQGPSSLLRWAAPEVITHGKHSTA
SDVWSFGILMWEVMSYGERPYWDMTEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKD
RARRPHFDQLVAAFDKMIRKPDTLQADGAPGDRPSQALLNPVALDFPCLDSPQAWLSAIG
LECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHNIQLLQQHLRQPGSVEV
Download sequence
Identical sequences ENSDORP00000008158 ENSDORP00000008158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]