SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008412 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008412
Domain Number 1 Region: 642-746
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-29
Family Cadherin 0.00059
Further Details:      
 
Domain Number 2 Region: 951-1055
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-27
Family Cadherin 0.00056
Further Details:      
 
Domain Number 3 Region: 537-649
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-27
Family Cadherin 0.00047
Further Details:      
 
Domain Number 4 Region: 323-426
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.00087
Further Details:      
 
Domain Number 5 Region: 1050-1167
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 6 Region: 428-543
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 1734-1945
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.92e-23
Family Laminin G-like module 0.0051
Further Details:      
 
Domain Number 8 Region: 845-946
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-23
Family Cadherin 0.0015
Further Details:      
 
Domain Number 9 Region: 1491-1576
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-18
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 10 Region: 747-848
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-18
Family Cadherin 0.0014
Further Details:      
 
Domain Number 11 Region: 3736-3765,3844-3923
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000126
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 
Domain Number 12 Region: 1430-1470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000205
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 13 Region: 1158-1260
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000757
Family Cadherin 0.01
Further Details:      
 
Domain Number 14 Region: 1657-1717
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000633
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 15 Region: 1978-2024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 1942-1976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000143
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008412
Domain Number - Region: 1409-1435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00781
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008412   Gene: ENSDORG00000008952   Transcript: ENSDORT00000008959
Sequence length 3974
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3652:89450:141250:-1 gene:ENSDORG00000008952 transcript:ENSDORT00000008959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSPLIREDTLRHPNFFRRNSGTEFGTRIQKRGQKEGSSWNSALKRGGLEELGGGWDPAVA
TGPGAQQIGGEALALCPEPTEAREDGEPGLEVPESVFMGLRAGRRNIRNGGGAPELQPAQ
PEVPAAHSREPGAGRGPGAPACWHPEVSSCGWPGPRRRGSVSPEALPPGGTGLGDMSPLP
SDLPAPSDDPESGSSRPPSRRGIVQTVEPSRCCREPWAPGPQGQGGQAAGRTALRRDCLP
GAAVSGPGWGSAPRAVRRAPPPASAPHESRTAPRRVSERMRFRGLFRRRLLPQEARPRRP
PCPKPGRMASEERPRPRRAANRHPQFPQYNYQTSVPENEAAGTSVLRVAAQDPDPGEAGR
LVYSLAALMNSRSLELFSIDPHSGLIRTAAELDRESMERHYLRVTAQDHGSPRLSATTMV
AVTVADRNDHAPVFEQAQYRETLRENVEEGYPIQLRATDGDAPPNANLRYRFVGPPAARG
ATAFEIDPRSGLISTSGRVDREHAESYELVVEASDQGQEPGPRSATVRVHITVLDENDNA
PQFSEKRYVAQVREDVRPHTPVLRVSAADRDKDANGLVHYNIISGNSRGRFAIDGLTGEI
QVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDVNDHAPIFVSTPFQVSVLE
NAPLGHSVIHIQAVDADHGENARLEYSLTGVAADTPFVINSATGWVSVSGPLDRESVEHY
FFGVEARDHGAPPLSASASVTVTVLDVNDNRPEFTTKEHHLRLNEDAAVGTSVVSVTAVD
RDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHDHC
YVHLNITDANTHRPVFQSAHYSVSMNEDRPVGSTVVVISASDDDVGENARITYLLEDNLP
QFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTYEVMVNDHDNAPQFVASH
YTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRL
DREAVPVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFVVRVKENSIVGSV
VAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQAT
SSPLVSRATVHVHLVDQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDPDVSDH
LFYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTAQCVLRVVI
ITEELLANSLTVRLENMWQERFLSPLLGHFLEGVGAVPTTPTEDVFIFNIQNDTDVGGTV
LNVSFSALAPRGAGAGAAGPWFSSEELQEQLYVRRAALAARSLLDVLPFDDNVCLREPCE
NYMKCVSVLRFDSSAPFLASASTLFRPIQPIAGLRCRCPPGFTGDFCETELDLCYSNPCR
NGGACARREGGYTCVCRPRFTGEDCELDTEAGRCVAGVCRNGGTCTNAPNGGFRCQCPAG
GAFEGPRCEVAARSFPASSFVMFRGLRQRFHLTLSLSFATVQPSGLLFYNGRLNEKHDFL
ALELVAGQVRLTYSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXTAAGVQTSSKKSLDLTGPLLLGGVPNLPENFPV
SHKDFIGCMRDLHIDGRRVDMASFVANNGTVAGCQAKLHFCDSGPCKNSGICSERWGGFN
CDCPVGFGGKDCRLTMAHPYHFHGNGTLSWDFGNDMAVSVPWYLGLAFRTRATQGVLMQV
QVGPHSTLLCQVDQGLLSITVTRGSGRAAHLLLDQMTVSDGRWHDLRLELQEEPGGRKGH
HVFLVSLDFSLFQDTMAVGSELQGLKVKQLHVGGLPPSSKEEVPQGLVGCVQGLWLGSTP
LGSPTLLPPTHRVNVEPGCVVTNACASGPCPPHADCLDLWQTFSCTCWPGYYGPGCVDVC
LLNPCQNQGSCRHLPGAPHGYTCDCVTGYFGHHCEHRMDQQCPRGWWGTPNCGPCNCDVH
KGFDPNCNKTNGQCHCKAAVRLCDEDHGWLEPDLFNCTSPAFRELLLLDGLELNKTALDT
VEAKKLAQRLREVTGQADYYFSQDVRVTARLLAYLLAFESRQRGFGLTATQDAHFNENLL
WAGSALLAPETEDLWAALGQRAPGASPGSAGLVQHLEEYAATLARNMELTYLNPVGLVTP
NIMLSIDRMEHLSSAQSTHRYPRYHSNLFRGQDAWDPHTHVLLPSQTPRPSPSQVLPTGS
STENSSVSSVVPPPVPPEPEPELGISIVILLVYRTLGGLLPAQFQAERRGARLPQNPVMN
SPVVSVAVFHGRNFLKGVESSISLEFRLLQTANRXXXXXXXWDPPGPEEQHGMWTARDCE
LVHRNGSHAWCRCSRTGTFGILMDASPRERLEGDLELLAIFTHVIIAVSVAALVLTAALL
LSLRSLKSNVCGIHANVAAALGVAELLFLLGIHRTHNQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAVGLDPEGYGNPDFCWISIHEP
LIWSFAGPVILVIVMNGTMFLLAARTACSTGQREAKKTSVFRTLRSSFLLLLLVSTSWLF
GLLSVNHSILAFHYLHAGLCGLQGLAVLLLFCILNADARAAWTPACLGKKAVPEEPRPAP
GPGPGAYNNTALFEESGLIRITLGASTVSSVSSARSGRAQDQDSQRGRSYLRDNVLVRHG
SAVDHTEHTIQAHAGPTDLDVAMFHRDAGADSDSDSDLSLEEERSLSIPSSESEDNGRTR
GRFQRPLRRAAQSERLLSHPKDVDGNDLLSCWPALGECEASPCALQTWGSERRLGLDTSK
DAANNNQPELALTSGDETTLGRAQRQRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXPCRLEPRDRGSTPRRQPPRDYPGAMAGRFGSRDALDLGAPREWLSTLPPPRR
PRDLEPQHPPLPLSPQRQLSRDPHLPSRPLDTPCRSSNSREPLDQGPGQHSSREALGPPP
QPLRAREELASGPSHGPSTEQLDILSSILASFNSSALSSVQSSSTPSGPHTTATPSATAS
ALGPSTPRSATSHSISELSPDSEPKDTQTLLSARPMELHKRDYHVERPLLNQEQLETLGH
RSSAPKTRQWQTWFQCSRSRARAFLLQHLPVLAWLPRYRVRDWLLGDLLSGLSVAIMQLP
QGLAYALLAGLPPVYGLYSSFYPVFIYFLFGTSRHISVVLRLIDTXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLIGATGISYGVELKKRYGVDVVGDIPAGLIPPKAPKPE
LFAQLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNFIGGFFQCFPVS
CSMSRSLVQESTGGNTXVAGAVSSLFILLIILKLGELFKDLPKAVLAATIIVNLKGMMMQ
FSDICRLWKTNRMDLLIWLVTFVATILLNLDIGLAVAIGFSLLLVVVRTQLPHYSILGQL
PDTDVYRDVTEYSEAKEVPGVKVFRSSATMYFANAELYGDALKKKCGVDVDHLIAQKKKL
LKKQEKKLKQQQKDQKSQKKAGPPLSACVSSPQVNTGDEIEDVTVNDQETTKTPNVSTLK
SLGLPQPDFHTLILDLGTLSFVDTVCIKNLKNIFRDFRDLEVEVYLAACNSPVVAQLEAG
QFFDASITKQHIFVSVHDAVTFALQHSKPDSITSTFLWVPFLSTTMKKLEVVLWLKWCPA
KKLKNSTGAGGSCL
Download sequence
Identical sequences ENSDORP00000008412 ENSDORP00000008412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]