SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008737 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008737
Domain Number 1 Region: 65-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.09e-53
Family Ankyrin repeat 0.0000993
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008737   Gene: ENSDORG00000009298   Transcript: ENSDORT00000009298
Sequence length 287
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4735:3786:48551:-1 gene:ENSDORG00000009298 transcript:ENSDORT00000009298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLEESRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
VTQGQGSWADRSPLHEAASQGRLLALRTLLSQGYNVNAVTIDHITPLHEACLGDHVACAR
TLLEAGANVNAVTIDGVTPLFNACSQGSASCTELLLEYGAKAQLESSLPSPTHEAANKGH
HECLDILISWGIDVDQEIPHLGTPLYVACMAQQFHCVWKLLYAGADVQKGKYWDTPLHAA
AQQSSTEVVNLLLEFGADINAKNTELLRPIDVATANSAMERILLQHE
Download sequence
Identical sequences ENSDORP00000008737 ENSDORP00000008737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]