SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008917 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008917
Domain Number 1 Region: 580-846
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-78
Family Protein kinases, catalytic subunit 0.0000243
Further Details:      
 
Domain Number 2 Region: 418-532
Classification Level Classification E-value
Superfamily PH domain-like 9.32e-35
Family Pleckstrin-homology domain (PH domain) 0.0000274
Further Details:      
 
Domain Number 3 Region: 257-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008917   Gene: ENSDORG00000009493   Transcript: ENSDORT00000009493
Sequence length 888
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_342:97736:156602:-1 gene:ENSDORG00000009493 transcript:ENSDORT00000009493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANNSPPSAQKSALPATVSAVLPTPSPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTV
SFLLQIGLTRENVTIEAQELSLSSVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSEN
ILQLITSADEIHEGDLVEVVLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXCGLNYHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
HVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYGRPTICQYCKRLLKGLFRQGM
QCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTDTDIPMDIDNNDMNSDGSRGLDDT
EEPSPPEDKMFFLDPSDLDVDRDEEPVKTISPSTSNNIPLMRVVQSIKHTKRKSSTMVKE
GWMVHYTSKDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRVSSPRDFTNISQG
SNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDIAQSWEKAIRQALMPVTPQASV
CTSPGQGKEHKDLATSISVSNCQVQENVXXXXXXXXXADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDML
EMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDE
DINDQIQNAAFMYPPNPWKEISSEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD
LREFEARIGERVTHESDDARWQIHAYTHNLAYPKHFLMAPNPDDETHP
Download sequence
Identical sequences ENSDORP00000008917 ENSDORP00000008917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]