SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009263 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009263
Domain Number 1 Region: 164-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.28e-20
Family Ankyrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009263   Gene: ENSDORG00000009852   Transcript: ENSDORT00000009855
Sequence length 791
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5066:16201:48591:-1 gene:ENSDORG00000009852 transcript:ENSDORT00000009855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTHPKEMVPLISRRTTAPCGNSVVLSEKRPAELTPTKKSAHFFLEIEGFEPNPTVTKTS
PPIFSKPMDSNIRQCLSGNCDDMDSPQSPQDDVTETPSNPNSPSANLAKEEQRRKKKRLK
KCIFTAVSEGCVEELVELLLELQELCKRRRGRDVPDFLMHKLTASDTGKTCLMKALLNIN
PNTKEIVRILLAFAEENDILDRFINAEYTEEAYEGQTALNIAIERRQRDIAAELIAAGAD
VNAHAKGAFFNPRHQHDGFYIRETPLALAACTNQPEIVQLLMENEQTDITSQDSRGNNIL
HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETMCNHDGLTPLQLAAKMGKAEILKYI
LSREIKEKPLRSLSRKFTDWAYGPVSSSLYDLTNVDTTADNSVLEIIVYNTNIDNRHEML
TLEPLHTLLHMKWKKFAKYMFFLSFCFYFFYNITLTLVSYYRPREEEALPHPLALTHKMG
WLQLLGRMFVLIWATCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFVQAVLVILSVFLY
LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKXXXXXXXXXXXXXXXXXXX
XXXXLASLIEKCSKDKTDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSTYPILFLFLLIT
YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL
CKVAEEDFRLCLRINEVKWTEWKTHVSFLNEDPGPIRRTVDFNKIQDSSRSNSKTTLNAF
EEIDEFPETSV
Download sequence
Identical sequences ENSDORP00000009263 ENSDORP00000009263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]