SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009340 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009340
Domain Number 1 Region: 1356-1473
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.2e-26
Family Ankyrin repeat 0.0000627
Further Details:      
 
Domain Number 2 Region: 1-139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 138-253
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 625-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000234
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 584-708
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 248-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000031
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 388-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000148
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 8 Region: 467-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000175
Family EGF-type module 0.016
Further Details:      
 
Domain Number 9 Region: 910-941
Classification Level Classification E-value
Superfamily Notch domain 0.000000131
Family Notch domain 0.0022
Further Details:      
 
Domain Number 10 Region: 504-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 427-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 12 Region: 699-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 351-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family EGF-type module 0.017
Further Details:      
 
Domain Number 14 Region: 872-903
Classification Level Classification E-value
Superfamily Notch domain 0.00000706
Family Notch domain 0.0065
Further Details:      
 
Domain Number 15 Region: 558-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000714
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 791-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000897
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009340
Domain Number - Region: 832-861
Classification Level Classification E-value
Superfamily Notch domain 0.00327
Family Notch domain 0.0032
Further Details:      
 
Domain Number - Region: 746-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0239
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009340   Gene: ENSDORG00000009936   Transcript: ENSDORT00000009939
Sequence length 1651
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6799:63117:86615:-1 gene:ENSDORG00000009936 transcript:ENSDORT00000009939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVSGWGGTVCEENLDDCITATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPC
HENAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFKC
LCPPGYTGSRCEADHDECKSQPCRTGSTCVDLLATFYCFCPPGLEGTLCEVEINECASDP
CLNHASCQDLLNGFLCICQPGFTGTQCEEDMDECTSSPCANGGHCQDQPGAFHCQCLPGF
EGPQCETEVDECLSGPCPTGASCLDLPGAFLCLCPSGFTGQSCDTPLCELNLCQAKQQCQ
DPGDKPHCLCPDGSPGCVPAQDNCTCHHGHCQRSSCVCDTGWTGPECEAELGDCNSTLCA
HGGTCYPQPSGYHCTCPTSHTGPTCSEEVTACHSRPCLNGGSCIASPGSYSCACPASHTG
SHCQTITDHCESAPCLNGGTCVNRPGAPSCLCATGFQGPCCEEKIYPSCADSPCRNRATC
QDGPQGPRCLCPPGYTGESCQTLMDLCAQKPCPNNGRCLQNGPSFQCLCLQGWTGPLCNF
PLSSCQKAAMNQGIEVSALCQNGGLCMDKGPSYFCHCPPGFGRLCQDHVNPCESQPCQYG
ACVAQPDGYLCQCAPGYSGQNCSSEPDACLSQPCHNHGTCTPKPGGFHCACPPGFVGLRC
EGDVDECLDQPCHPTGTAACHSLANAFYCQCLPGYTGQWCEVETDPCQSQPCSHGGACEA
TPGPPPGFTCHCPKGFEGPTCSHRAPSCGTHHCHHGGLCLPSPKLGLPPFCACLSGFGDP
DCLTPPAPQGCGPPSPCLHNGSCSETPGLGQPGFRCSCPPDSPGPRCQRSGAEECEGRGG
DGACDPGCSGPGGNWDGGDCSLGVPDPWKGCPPNSQCWLLFRDGQCHPQCDSEECLFDGY
DCENPPTCIPAYDQYCQDHFHNGHCEKGCNTAECGWDGGDCRPEDGDLKWGPSLALLVVL
SPSALDQQLLTLARVLALTLRVGLWVRKDGEGRDMVFPYPGARAEEELGRTRNSSHQEKA
APPLGKETDSDGTGFVVVLGVDLSNCGPDHPASSCPWDSQLLLRFLAAMAAVGALEPLLP
GPLLAAHPQAGIVPPANQLPWPVLCSPVAGVLLLALGALLVLQLIRRRRREHGALWLPPG
FTRRPQTQRTPRRRRPPLGEDSIGLKTLKPEAEVDEDGVVMCSVPEEGEEVGQVEEMVSP
PKCQLWPLNGGCGEIPQIAMLTPPQESEMEASDVDTCSPXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLMLARLMEDLEELIAAGANVGA
ADKWGKTALHWAAAVNNDRAARSLLQAGADKDAQDGREQTPLFLAAREGAVEVAQLLLGL
GAARGLRDQAGLAPADIARQRNHWDLLTLLGGAGPPAARHTVSPDRETGAFSRARTASGS
VPPHGGGAPPRCRTLSAGARPRLGGACLQARSLSGDLAARGSRAYPHSRSPSGGGAGEGP
PPRGRRVSAGLRGPRPNPSIVRGRPACVAGRRSKASVDGWPRDWVALGACPASSTPIPPP
CLTPSPERGSPQVVWALPAHGGASLNLGEGN
Download sequence
Identical sequences ENSDORP00000009340 ENSDORP00000009340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]