SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009589 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009589
Domain Number 1 Region: 418-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.12e-74
Family Protein kinases, catalytic subunit 0.0000000486
Further Details:      
 
Domain Number 2 Region: 860-1002
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 6.93e-58
Family FAT domain of focal adhesion kinase 0.00000741
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-41
Family Second domain of FERM 0.0000236
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.65e-34
Family First domain of FERM 0.00035
Further Details:      
 
Domain Number 5 Region: 261-366
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-31
Family Third domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009589   Gene: ENSDORG00000010200   Transcript: ENSDORT00000010202
Sequence length 1005
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2258:31791:73575:1 gene:ENSDORG00000010200 transcript:ENSDORT00000010202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPVDIEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEVREIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRSDYMQCYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANVDQETYRCELIQGWNITVDLVIGPKGIRQLTGQDAKPTCLA
EFKQIKSIRCLPLEEGQAVLQLGIEGAPQSLSIKTSSLAEAENMADLIDGYCRLQGEHKG
SLIIHPKKDGEKRNSLPQIPTLNLEARRSHFSESCSISDIYAEIPDDTLWRPGGPQYGLA
REDVVLNRILGEGFFGEVYEGVYTDHXXXXXXXXXKTCKKDCLDTEKFMSEAVMMKNLDH
PHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVPTLVLYSLQICKAMAYLESI
NCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFRRFT
TASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPELCPPVLYTLMTRCWD
YDPSDRPRFTELVCSLSDIHQMEKDIAIDQERSARYRPPKILEPATYQEPPPKPSRPKYR
PPPQTNLLAPKLQFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHRHNVFKRSMREEDF
IRPNSREEAQQLWEAEKIKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPE
KEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPE
GYVVVVKNVGLTLRKLIGSVDSILPSLPSSARTEIEGTQKLLNKDLAELINKMRLAQQNA
VTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLARPPAE
Download sequence
Identical sequences ENSDORP00000009589 ENSDORP00000009589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]