SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009733 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000009733
Domain Number - Region: 24-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000762
Family HkH motif-containing C2H2 finger 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009733   Gene: ENSDORG00000010356   Transcript: ENSDORT00000010356
Sequence length 211
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_198:143:8654:1 gene:ENSDORG00000010356 transcript:ENSDORT00000010356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTVSMLTAHRSGKKHLSSLQLFYG
KKHPRKERQNPRQQNELIEELKAEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEAPGS
SVSCSPLPAPEVELQSEKINREPETEAGPQAKESETVSAPTSVSPTRRRIMDHYLRLRSS
GWIPDGQGRWRKDENVEFDSDEEEPPDLPLD
Download sequence
Identical sequences ENSDORP00000009733 ENSDORP00000009733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]