SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010222 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010222
Domain Number 1 Region: 2819-2998
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-37
Family Laminin G-like module 0.00000491
Further Details:      
 
Domain Number 2 Region: 2231-2417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.53e-35
Family Laminin G-like module 0.00098
Further Details:      
 
Domain Number 3 Region: 2628-2808
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-32
Family Laminin G-like module 0.000056
Further Details:      
 
Domain Number 4 Region: 2063-2231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-29
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 2415-2602
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.45e-26
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 6 Region: 781-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000725
Family Laminin-type module 0.0015
Further Details:      
 
Domain Number 7 Region: 1335-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 976-1024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 9 Region: 834-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 10 Region: 376-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 11 Region: 927-974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000053
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 12 Region: 306-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000809
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 13 Region: 689-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000014
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 14 Region: 883-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000181
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010222
Domain Number - Region: 1290-1317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00123
Family Laminin-type module 0.061
Further Details:      
 
Domain Number - Region: 1037-1084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Laminin-type module 0.027
Further Details:      
 
Domain Number - Region: 1808-1924
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0085
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 
Domain Number - Region: 1710-1784
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0671
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010222   Gene: ENSDORG00000010869   Transcript: ENSDORT00000010876
Sequence length 3002
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1209:13649:138521:-1 gene:ENSDORG00000010869 transcript:ENSDORT00000010876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFPAILNLASNAHISANATCGEKGPEMYCKLVEHVPGRPVRNAQCRVCDSNSTNPRESHP
IAHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHTSL
INGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMTLSHRDPRDLDPIVTRRYYYSI
KDISVGGMCICYGHASSCPWDETAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXCEECNCHNKAKDCYYDENIAKQKRSLNTSGKFEGGGVCIDCQQNTTGINCETCIDGYY
RPHKISPYENEPCRPCDCHPVGSLSSVCIKDDLHSDIHSGKWPGQCPCKEGYAGEKCDRC
QFGYRGFPNCVRCECNLAGSVNDDPCTEPCLCKVSNMSGWLITDLISPHKIQSQQDELGG
RQQISINNTAVMKRLAPKYYWSAPETYLGNKLTAYGGFLKYTVSYDIPADTVDDDLMSHA
DIIIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXLNSVSLDTANQNAIDLATATDVEHCECPQGYMGTSCEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXACAHNTTGDQCEQCLPGFYGVPSRGTAEDC
QPCACPLSTASNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCADGYYGNPTVPGETCVP
CDCNGNVDLSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRACDCHENG
SLSGVCNIDTGLCDCKAHVTGQQCDQCLPGYYGLDSGHGCQPCNCSVTGSMSDDCTDEGQ
CHCVPGVAGKKCDRCSHGFFGYQDGRCTPCDCAHTHHTCDPESGKCLCPPHTRGPKCEEC
EDGYWGLDVERGCQACNCSHEGSTSSQCNVLSGQCHCKPEFDGHNCDQCSLGYRDFPDCI
SCNCDLRGTQADTCDPEQGLCSCAEKTGACTCKDNVFGLQCSECRAGTFGLHADDPLGCT
PCFCFGLSQLCSELEGYVRTPVTLASDQPLLRVVSQSDLWGTTKGVHFQAPDVLLDAVTV
RQHVHSEPFYWRLPKHFQGDQLLAYGGKLRYSVAFYSSTGTGTSNYEPQVLIKGGRARKH
VIYMDEPAPENGVRQDRVVAMHENFWKYFNSVSEKPVTRSDFMSVLSNIEYILIKASYGH
GLQQSRISNISMEVGRKAGDLHPRGESASRLESCICPPGTTGFSCQDCAPGYHRGKLPED
GGRGPPPLLAPCVPCSCNNHSDSCDPETGKCLNCRANTAGDHCDVCAPGYYGTVTGSPQD
CSPCACPHHPPASFSPTCVPEGAGGFRCDACVPGHEGQFCEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCDDECIGVLLNDL
DNVGDAILSVNLTGIFPAPYGILSDLENKTRYFQESLFKKYTQKNQTEIQLDGVVEEIDN
LQKELTRVLTSSEQVNMATERILNESQDLATSIELLLRNSKEILEKAATLNQTMDGDFQP
PSSILQNLQQNISSLLEGIRKRSFTQLLENVTHELKAAEDLLSQIQKNFQKPQKQLEVLM
QTASRLLSKHSSELQAVDELLREAETKTQESNRLLHIVKANLGKFSNEKLRVQEEQNVTS
ELVVEGRGLVDAATTQADTTKNLLAELEQHWNEVLLWTAKIRHHVDNLVMQMSKRKAIDL
VHRAEYHATELQSLAGALDSALENVRDVSLNATSAAHVYSNIQNLLEQSEKLAKDAHNTG
NKTSQVAESLASRSKAALQRSSRFLKESNSLSGKQQGVTLGLSEMKNMTNRFQETTDKIA
RQTNASLLILRAIPEXXXXXXXXXXXXXXXXXXSAGTTLQEVLKLSRKLFATSTDLSRVN
LTLQETKELLQDSSMTTLLAGRKVKDMETQANLLWNRLKPLKTLEENLSRNLSEIKLLIS
QARKQAASIKVAVAADRDCIRAYQPQISSTNYNNLTLNVKTQEPDNLLFYLGSSSGSDFL
AVEMRRGKVAFLWDLGSGSTRLEFPDVLINDDRWYSIHITRFGNLGSLSVKEMSSTQNPP
MKTSKSPGTANVLDINNSTRMFVGGLGGQIKKSSAVKVTHFKGCMGEAFLNGKSIGLWNY
IEREGTCHGCFGSSQNEDGSFHFDGNGYSVVEKTLRTTVTQIVMLFSTFSPNGLLLYLAS
NGTKDFLSIELVHGRVKVMVDLGSGPLTLITDRRYNNGTWYRIAFQRNRKQGLLSVFDTY
DSSDKETKQGETPGASSDLNRLEKDLIYVGGLPRSRLVRKGVTSQSYVGCIKNLEIGRSS
FDLLRSSYGVRKGCVLEPIRSVSFLRGGYIELPPKPLSPESEFLVTFATKNSSGIILAAL
GKDVEAAGHPFYAILLNEGHVEVHISLGNGGSLRKALLHAPRGSLDDGEEHSISLVRNRR
IITVQLDENNPVEIRLGSLVENRTLNMSHMYVGGLPEGEDTSVFKMRRSFHGCIKNLVFD
LELVDFTRAKDYETANLGTCLLIERPRSALHGEDNEVPPEPPTLPSQCAADVTSGYVSGA
HQFGLSQSSHLVLPFNQSAVRKRLLVQLSIRTFASSGLIYHLAHQNQADYATLQIHAGRL
HFMFDLGKGRTRVSHPALLNDGKWHTVKTEYSKRKGFLTVDGQEAPAVSIVGDGTMLDVE
GKLRLGGLPAQYRARNIGNITHSIPACIGEVTVNGKPLDKENPESAFAVGRCHEVAQEGT
FFEGSGYAALVEEGYRVRSDLNITFEFRTASENGVLLGISSAKVDAIGLEIVDGKLLFHV
NNGAGRITATYKPKAGRTLCDGKWHMLQANKSKHRIMLIVDGEAVGAESPHTQSTSADTH
NPIYVGGYPANVKQNCLSSRASFRGCLRKLTLTKGPQVQTYDFSRAFDQHGVFPHSCPGP
EP
Download sequence
Identical sequences ENSDORP00000010222 ENSDORP00000010222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]