SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010487 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010487
Domain Number 1 Region: 1167-1284
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-28
Family Ankyrin repeat 0.00063
Further Details:      
 
Domain Number 2 Region: 241-341,409-448
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.2e-22
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 1729-1799
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.24e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 4 Region: 656-724
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000155
Family Ankyrin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010487   Gene: ENSDORG00000011159   Transcript: ENSDORT00000011160
Sequence length 2597
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2763:7014:134346:-1 gene:ENSDORG00000011159 transcript:ENSDORT00000011160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKATVPVAAAAAAEGEGSPPAVAAVAGPPPAAAAGGGGGGSSGARSASSPRGMVRVCDL
LLKKKPPQQQHHKAKRNRTCRPPSSSESSSDSDNSGGGGGGGGGGGGGGGGGGGTSSNNS
EEDDDDDDEEEEVSEVESFILDQDDLENPMLETASKLLLSGTADGADLRTVDPETQARLE
ALLEAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXR
SLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDR
GIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLEM
VRFLLEAGADQEHKTDEMHTALMEACMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANVN
RTTANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLL
DYPNNLLSAPPPEVTQLTPPSHDLNRAPRVPVQALPMVVPPQEPDKPPANVATTLPIRNK
AASKQKSSSHLPANSQDVQGYITNQSPESIVEEAQGKLTELEQRIKEAIEKNAQLQSLEL
AHADQLTKEKIEELNKTREEQIQKKQKILEELQKVERELQLKTQQQLKKQYLEVKAQRIQ
LQQQQQQSCQHLGLLTPVGVGEQLSEGDYARLQQVDPVLLKDEPQQTAAQMGFAPIQPLA
MPQALPLAAGPLPPGSIANLTELQGVIVGQPVLGQAQLAGLGQGILTETQQGLMVASPAQ
TLNDTLDDIMAAVSGRASAMSNTPTHSIAASISQPQTPTPSPIISPSAMLPIYPAIDIDA
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVVELLLARGANKEHRNVSDYTPLSLAASGGYVN
IIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALT
LACFQGRTEVVSLLLDRKANVEHRAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGHVKVVRYLVKEVNQFPSDSECMRYIATITDKEMLKKCHLC
MESIVQAKDRQAAEANKNASILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEEQRR
KLEEIEAKNKENFELQAAQEKEKLKAEEEPEVLTEPPSATTTTTIGISATWTTLAGSHGK
RNNTITTTSSKRKNRKNKISPENVQIIFDDPLPISYNQPEKVNGESKSSSTSESGDSDNM
RISSCSDESSNSNSSRKSDNHSPAVVTTSVTSKKQPSVLVTFPKEERKSVSGKTSVKLSE
TINEATSNSLSTCTKSGPSPLSSPNGKLTVASPKRGQKREEGWKEVVRRSKKVSVPSTVI
SRVIGRGGCNINAIREFTGAHIDIDKQKDKTGDRIITIRGGTESTRQATQLINALIKDPD
KEIDELIPKNRLKSSSANSKIGSSAPTTTAANSSLMGIKMTTVALSSTSQTATALSVPAI
SSASAHKTIKNPVNNVRPGFPVSLPLAYPPPQFAHALLAAQTFQQIRPPRLPMTHFGGTF
PPAQSTWGPFPVRPLSPARATNSPKPHMVPRHSNQNSSGSQVNSAGSLTSSPTTTTSSSA
STVPGTSTNGSPSSPSVRRQLFVTVVKTSNATTTTVTTTASNNSTAPTNATYPMPTAKEH
YPVSSPSSPSPTAQPGGVSRNSPLDCGSASPNKGASSSEQEAGSPPVVETTNNRPPNSSS
SGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGSVVSSQS
TPESMLSGKSYLPNSDPLHQSDTSKATGFRPPLQRRAPSPSGIVNMDSPYGSVTPSSTHL
GNFASNLSGGQMYGPGAPLGGAPAAANFNRQHFSPLSLLTPCSSASNXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXKVDWCNPGMGNPMIHRPMSDPGVFSQHQAIERDNTGIVTPSGTFHQHVP
AGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGTGGPIFNGPHAADPSWNSLIKMVSSSTVW
TGPWAPHMNSVHMNQLG
Download sequence
Identical sequences ENSDORP00000010487 ENSDORP00000010487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]