SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010554 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010554
Domain Number 1 Region: 3-166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.12e-31
Family Laminin G-like module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010554   Gene: ENSDORG00000011232   Transcript: ENSDORT00000011232
Sequence length 177
Comment pep:novel scaffold:dipOrd1:scaffold_73560:358:4188:-1 gene:ENSDORG00000011232 transcript:ENSDORT00000011232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEVVHFDGKSSLLYTFIQKSTTPTKEVISLNFNSRKSDGILFHRQGRNGKNFTLELAQGK
LVLSLNSGEANMSSLDVPAALSLGSLMDDQHWHSILLELYSTHGSLTVDKYTQLFQAQPG
SSYLDLGYKISFGGIPEHGKLSTFPHKNFDGCFENLFYNGVDITDLSKKYKSQILFM
Download sequence
Identical sequences ENSDORP00000010554 ENSDORP00000010554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]