SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010917 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010917
Domain Number 1 Region: 216-279
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 424-528
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000066
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 3 Region: 25-74
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000278
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Domain Number 4 Region: 544-734
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000769
Family SPRY domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010917
Domain Number - Region: 158-200
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0547
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.055
Further Details:      
 
Domain Number - Region: 266-341
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.085
Family Apolipoprotein A-I 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010917   Gene: ENSDORG00000011617   Transcript: ENSDORT00000011617
Sequence length 758
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5167:52045:62810:1 gene:ENSDORG00000011617 transcript:ENSDORT00000011617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
LGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGA
LHPQVIMFPCPACQGDVELGERGLAGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPL
EATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
CQRLVCQLCRVRRTHSGHKITPVLNAYQALKDKLTKSLTYILGNQDTVQTQICELEETVR
HTEVSGQQAKEEVSQLVRSLGAVLEEKRASLLQAIEECQQERLARLSAQIQEHRSLLDGS
LVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGRELKLL
TELNFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRWQ
RREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDGRWGA
SRERLAISKDQRAVRSVPGLPLLLAAERLLTGCHLSVDVVLGDVAVTQGRSYWACAVDPA
SYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDATVEASPPFAFLTIGMGKI
LLGSGASANAGLTGRDGPAAGCTVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDCS
GPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD
Download sequence
Identical sequences ENSDORP00000010917 ENSDORP00000010917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]