SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011073 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011073
Domain Number 1 Region: 720-770,845-877
Classification Level Classification E-value
Superfamily HCP-like 0.0000000000767
Family HCP-like 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011073
Domain Number - Region: 527-599
Classification Level Classification E-value
Superfamily HCP-like 0.000183
Family HCP-like 0.009
Further Details:      
 
Domain Number - Region: 247-390
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.038
Family Clostridium neurotoxins, the second last domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011073   Gene: ENSDORG00000011773   Transcript: ENSDORT00000011780
Sequence length 1091
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_933:995:117723:-1 gene:ENSDORG00000011773 transcript:ENSDORT00000011780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPQPKRPNNPLHRRELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXDLNVKWEEHLLHAVAKNYTLLHSVPPFQRPFKD
HQVCLEWNMGYLWNLWVNRIPQCPVENDEATLLAFPYASSGENTGIVKKLLRFQNRELEA
TRCQRTDYPVFTVSLWLYLLHYCKANLCGILYFVDADEMYGTPSIFLTEEGYLHIQMHLV
KGEDLAVKTKFTLPLKEWLLDISFHGGQIMVTTSLGQDLKSHHNQTISFREDFHYNDTAG
YFIIGGSRYVAGIQGFFGPLKYYRLRSLQPDQIHNPFLQKQLAEQVKLYYERCAEVQEII
SVYTSTAQVGRERQEACDLHNSYLDLWRRYGRPSMCTTFPWEKELRGKHPGLFQVLLEME
VPRSQNESVLEIGGKIFEQAVKRLSSVDGLHQISSVVPFLMDSSCCGYHKASYYLAVFYE
TGLNVPRDPLQGMLYSLVGGQGGERLSSMNLGYKHYQGVDNYPLDWELSYAYYSNIATKT
PLDQHTLQGDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
LHQAVNGLGWYYHKFKKNYARAAKYWLKAEEMGNPDASYNLGVLYLDGIFPGVPGRNLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWAKHVAEKNGYLGHVIRKG
LNAYLEGSWHEALLYYVLAAETGIEISQTNLAHICEERPELAGRYLGVNCVWRYYNFSVF
QIDAPSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGFFNLALLIEEGAIIP
HHILDFLEIDPTLHSNNVSILRELYERCWSHSNEESLSPCTLAWLYLHLRLIWSAILHSA
LIYFLGTFLLSVLIAWIVHRFQSISATGSPPAPAWASPESTVPTANPAVPPAADVSNQDQ
PSIANNPEPHG
Download sequence
Identical sequences ENSDORP00000011073 ENSDORP00000011073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]