SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011286 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011286
Domain Number 1 Region: 53-290,325-350
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.64e-65
Family BAR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 441-558
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.02e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.0000053
Further Details:      
 
Domain Number 3 Region: 563-631
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.99e-22
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 4 Region: 316-433
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-20
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011286   Gene: ENSDORG00000012007   Transcript: ENSDORT00000012008
Sequence length 1136
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4080:8902:263198:-1 gene:ENSDORG00000012007 transcript:ENSDORT00000012008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEVKQDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCAVKNGILTIS
HATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEE
ALTMAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDVCCDCGSSEPTWLSTNLGILTCIEC
SGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMT
IRKEYITAKYVDHRFSRKTCSSPTAKLNELLEAIKSRDLLALVQVYAEGVELMEPLLEPG
QELGETALHLAVRTADHTSLHLVDFLVQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXTDSPTSPTSEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRT
LSDPPSPLPHGPPNKGAIPWGNDVGPASSSSKAANKFEGLSQQSSTSSAKTALGPRVLPK
LPQKVALRKTETSHHLSLDKANVPPEIFQKSSQLAELPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXELPPKPQLGDIPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKTQQ
PSDVTQKSHPGDLSPHVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGHIEGQPERKGVFPVSFVHILSD
Download sequence
Identical sequences ENSDORP00000011286 ENSDORP00000011286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]