SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011377 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011377
Domain Number 1 Region: 215-411
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-38
Family SPRY domain 0.00026
Further Details:      
 
Domain Number 2 Region: 74-143
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000179
Family RING finger domain, C3HC4 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011377   Gene: ENSDORG00000012101   Transcript: ENSDORT00000012100
Sequence length 414
Comment pep:novel scaffold:dipOrd1:scaffold_26312:5339:10889:-1 gene:ENSDORG00000012101 transcript:ENSDORT00000012100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWWGDSPRPRLLEREAIPKAKVHEGGGERAIESASSRGGRPTALSPAIAGVSERVAPRPQ
LPMEAPELGPGLVERLEQLATCPLCGGPFEDPVLLACEHSFCRACLARCWGAPSALGAEA
PPTACPCCGLPCPRRSLRSNVRLAVEVRISRGLREKLAEPGARTGKRRGGRIPTMGCLDP
HGEDMRKTWRRFDVPRPKSSNSEEDLPEDYPVVKNMLHRLTADLTLDPGTAHRRLLVSTD
RRSVRLAPPGTPAPLDGPARFDQLPAVLGAQGFGAGRHCWEVETAETASGRDSSGEDEED
GESRYAVGAAGESVQRKGRIRLCPAEAVWAVEGRGGRLWALTAPEPTLLGGAGPPPRRIR
VDLDWERGRVAFYDGRSLDLLFAFQAPGPLGERIFPLLCTCDPRAPLRIVPGES
Download sequence
Identical sequences ENSDORP00000011377 ENSDORP00000011377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]