SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011460 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011460
Domain Number 1 Region: 1202-1306,1370-1529
Classification Level Classification E-value
Superfamily Cullin homology domain 3.01e-36
Family Cullin homology domain 0.0013
Further Details:      
 
Domain Number 2 Region: 766-957
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.08e-32
Family APC10-like 0.005
Further Details:      
 
Domain Number 3 Region: 359-432
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.61e-31
Family CPH domain 0.00000975
Further Details:      
 
Domain Number 4 Region: 112-230,652-729
Classification Level Classification E-value
Superfamily ARM repeat 0.00000034
Family RPA1889-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011460   Gene: ENSDORG00000012188   Transcript: ENSDORT00000012188
Sequence length 1693
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1825:149293:164274:-1 gene:ENSDORG00000012188 transcript:ENSDORT00000012188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELVRQRVGHDGHPEYQIRWLILRRGDDGDSGQVDCKA
EHILLWMSDDEIYANCHKMLGEDGQVIGPSQESAAEAGALDKSVLGEMETDVKSLIQRAL
RQLEECVGTMPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQVRWSAG
RMIQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGIQL
PQLPGRLLFSLVKHFLHVTSLLDQLNDNTGEAGAQNNPAPEELSVERGQLELEFSMAMGT
LISELVQAMRWDWASSKPGSSPRAPYSIFRPRAEDASPGAAPFQAHRFFRRSRQFRPPTE
FASSNTYALYVRDMLQPGMRVRMLENYEEISAGDEGEFRQSNNGVPPVQVLWESTGRTYW
VHWHMLEILGFEEDIEDVVEADEFHGAVVSGALGGALPSWHWKPMMELCAVPYVLPEEED
AEESEHLTQAEWWELLFFVRKLESSDRQEVVQLLQDNMDGEVLNEEILPELAVPIELAQE
LLVALPRRLDDSALRDLFNCRIYRRYGPEALARPPAYPTLLGAQAQPLKSEDTDKMEVKE
PPQSPSPALQSLVEGLGPAGNLLVALERALSSKGCREDEVKPCLLQLQRQPQPFLALMQS
LDTPATNKTLHLTALRILTQLVDFSEALLLPWHEAMDACMVCLRSPNTDREVLQELILFL
HHLTSVSRDYAVVLNQLGARDAISKALEKHLGKLEMAQELRDMVFKCEKHAHLYRKLTTN
ILGGCIQIVLGQIEDHRRTHRPIKIPFFDVFLRYLCQGSNMELKDKCWEKVEVSSNPHRA
CKLTDRNPKTYWESKGSAGSHHITLHMRRGVLVRKLTLLVAREDSSYMPARVVVCGGDSA
STLNTELNSVNVMPCASRVTLLENLTRFWPIIQIRIKRCQQGGIDTRIRGLEILGPKPIF
WPVFREQLCRHTRLFYMVRAQAWSQDIAEDRRSLLHLSTRLNGALRQEQTFADLFLPDDE
AAQALGKTCWEALVSPLVQNITSPDEHGASPLGWLLDQYVECRETAHNPQSRAAAFSSKV
RRLTHLLVHVEPCETAPPVVATPRPKGRNRSHDWSSLATRGLPSSIMRNLTRCWQAVVEE
KVNNFLTSHWRDDDFVPRYCERFYNLQKSSSELFGPRAAFLLALQNGCAGALLKLPFLRA
AHVSEQFARNIDQRIQGSRIGGARGMEMLAQLQRCLETVLVFSGLEIATTFEHYYQHYMA
DRLLNMGFNWLEGAVLEQIGLCFPNRLPQQMLQSLSTSEELQRQFDVYQLQQVDQELLKL
EDTEKKSQVGNEASGQERESQKEEDAGLAAAIAMTQGEEEEEEEQEEEEEEEGEADLYSE
GAMPKVSVIVLSPRYWPVDSICHTLDPQTCLPPSLRGTLTRYSNFYNTSQSHPTLERGLQ
RRLQWTWLGRAELQFGDQTLHVSTVQMWLLLYLNDLKVVSVESLLALSGLPVDMLNQAIG
PLTSSRGPLDLQEQKDVPGGVLKIRDGSKEPRPRRGDVWLVPPQTYLKAEDEEGRNLEKR
RNLLNCLVVRIVKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGKGGACNSTDVLS
CILHLLGKGTLRRHDDRPYMLSYAVPVTVMEPHTESLNPGISGPNPPLTFHTLQIRSRGV
PYASCTHSFSTFR
Download sequence
Identical sequences ENSDORP00000011460 ENSDORP00000011460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]