SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011516 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011516
Domain Number 1 Region: 332-414
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000233
Family Ankyrin repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 519-577
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000222
Family Second domain of FERM 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011516
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0889
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011516   Gene: ENSDORG00000012249   Transcript: ENSDORT00000012249
Sequence length 736
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_8:1819:22759:-1 gene:ENSDORG00000012249 transcript:ENSDORT00000012249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPENIEDAYVAVIRPKNAASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQA
NSEITQGILDYVVETTKPISPANQGIRGKRVVLMKRFPLDGEKMGREAALFIVPSVVKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCVYNPLFGSDLQY
TNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPEVDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYE
KVRIYRMDGSYRSVELRHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKKIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLKYGCFMWQLGDADTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPTERNS
Download sequence
Identical sequences ENSDORP00000011516 ENSDORP00000011516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]