SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011601 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011601
Domain Number 1 Region: 921-1179
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-45
Family YWTD domain 0.0000000858
Further Details:      
 
Domain Number 2 Region: 343-424
Classification Level Classification E-value
Superfamily GFP-like 7.74e-29
Family Domain G2 of nidogen-1 0.0000713
Further Details:      
 
Domain Number 3 Region: 715-822
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.49e-21
Family Thyroglobulin type-1 domain 0.0005
Further Details:      
 
Domain Number 4 Region: 300-340,578-675
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.69e-20
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 5 Region: 828-898
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.31e-19
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 6 Region: 492-567
Classification Level Classification E-value
Superfamily GFP-like 4.39e-19
Family Domain G2 of nidogen-1 0.00049
Further Details:      
 
Domain Number 7 Region: 667-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000507
Family EGF-like domain of nidogen-1 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011601   Gene: ENSDORG00000012337   Transcript: ENSDORT00000012340
Sequence length 1189
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6133:94771:154948:-1 gene:ENSDORG00000012337 transcript:ENSDORT00000012340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNTFQAVLASDESDTYALFLYPINGLQFFGTRPKESYNVQLQLPARVGFCRGESEDLKRE
GSYFSLTSNEQSVKNLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXALPEGILCGRPVSLTLSQGRYVVGMEDISSNAEVFTYNAGR
QETCEHSHDQCSRHAFCTDYATGFCCHCQSRFYGNGKHCLPEGAPHRVNGKVSGHLRVGP
TPVHFTDVDLHAYIVGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKPGSENG
FSLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVTSTSSRDYSLTLGDINQTWSYRIHQNVTYQVCRHAPRHQAVPATQQL
TVDRIFALYNEDEGVLRFAVTNQIGPVEADSGPAPVNPCHDGSHVCDSTAQCHAGTGTDY
TCECAPGYQGDGRSCVDVNECATGFHHCGPNSVCINLLGSYRCECRSGYELAGDQRSCTL
IVPPPNPCEDGSHTCAGQARCIHHGGSTFSCACLPGYTGSGHQCSDVDECAENRCHSAAT
CYNTPGSFSCRCQPGYHGDGFQCSPDSTSGLKPCEQQQRYAQAQHAYPGSRLHIPQCDDQ
GNFLPLQCHGSTGFCWCVDSNGHEVPGTQTPPGSTPPHCGPPPEPTQRPRTVCERWRENL
LEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIP
TVAPPIVRPTPRPDVTPPSVGTFLLYAQGQQIGHLPLNGTQLQKDAAKTLLSLHGSIVVG
LDYDCRERMVYWTDVAGRTISRVSLEPGAEPETIVNSGLISPEGLAIDHFRRTMYWTDSG
LDKIERAQLDGSQRKVLFHTDLVNPRAITVDPIRGNLYWTDWNREAPKIETSSLDGENRR
ILVNKDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLNYPFSIISYAD
HFYHTDWRRDGVISVNRHSGEFTDEYLPEQRSHLYGITVVYPYCPTGRK
Download sequence
Identical sequences ENSDORP00000011601 ENSDORP00000011601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]