SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011857 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011857
Domain Number 1 Region: 1563-1675
Classification Level Classification E-value
Superfamily C-type lectin-like 3.77e-47
Family Noncollagenous (NC1) domain of collagen IV 0.0000016
Further Details:      
 
Domain Number 2 Region: 1451-1560
Classification Level Classification E-value
Superfamily C-type lectin-like 3.06e-44
Family Noncollagenous (NC1) domain of collagen IV 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011857   Gene: ENSDORG00000012606   Transcript: ENSDORT00000012608
Sequence length 1676
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1216:225048:360364:1 gene:ENSDORG00000012606 transcript:ENSDORT00000012608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRGVNLAAGLFLLALSLWGQPAEAAACYGCSPGSKCACSGVKGEKGEQGYPGVRGHPG
LPVFPGPEGPPGHQGQKGDDGIPGPPGPKGIRGSPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGSPGYPGRPG
IQGPAGPMGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDVEFQKGDQGDPGDPGPPGPPGMCGPPGPPGGVKGEKGEQGEPGKRGKP
GKDGENGQPGIPGLPGDPGYPGEPGRDGQKGQKGDTGPPGPPGLVIPTPGTGVIVGEKGN
PGLPGLPGEKGERGFPGVQGPPGLPGPPGTAVTGPPGPPGFPGERGQKGDNGPPGISIPG
SPGLDGQPGAPGLPGPPGPPGPYIPIRDELCKAGPPGSPGTPGDKGFPGEQGVKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSLGIPGQKGEKGHAGATGLKGLPGIPGAPGTPGF
PGSKGDPGDILTLPGMKGEKGELGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPNGYFSIG
DPGLPGQPGFPGIPGSKGEPGSPGIGLPGPPGLKGPKGDPGQTITQPGKPGLPGHPGRDG
EVGLPGDPGLPGQPGFPGIPGSKGEPGSPGIGLPGPPGLKGFPGIPGPPGAPGTPGRIGL
EGPPGPPGFPGPKGEPGFGLPGPPGPPGIPGFKGTLGPKGDRGFPGPPGSPGRTGLDGLP
GPKGDIGPNGQPGPVGPPGLPGIGVQGPPGPPGIPGPIGQPGLHGLPGEKGDPGPPGFDI
PGPPGDRGSPGLPGAPGPIGPPGSPGLPGKAGASGFPGIKGEMGMMGPPGPPGPLGIPGR
SGVPGLKGDDGLQGEPGLPGPEGEKGGKGEPGLPGPPGPIDPSRLGSKGEKGEPGLPGIP
GLSGPKGYQGLPGDPGQPGLIGQPGLPGPPGPKGNPGLPGQPGLIGPPGLKGNLGDMGFP
GPQGVDGPPGPPGVPGQPGSPGLPGQKGDKGDPGVSGIGLPGLPGPKGEPGLPGYPGNPG
TKGSVGDIGFPGLPGTPGAKGQPGLPGFPGTPGPPGPKGIIGPPGNPGLPGEPGPVGGGG
HPGPPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGIPGPPGLPGLSGQKGDGGSPGIPGN
PGLPGPKGEPGFQGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPPGRPGPTGFKGLPGPE
GPRGLPGNGGIKGEKGNPGPPGQPGLPGLKGDQGPPGLPGNPGRPGLNGMKGDPGLPGVP
GFPGMKGPIGIPGSAGLEGEPGLTGPPGPPGLPGPSGQSIIIKGDAGPPGVPGPPGLKGP
PGLPGPQGLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRGLDGPPGPDGLQGP
PGPPGSSSVAHGFLITRHSQTTDAPQCPHGTIQIYEGFSLLYVQGNKRAHGQDLGTAGSC
LRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPKPMPMNMEPLKGQSIEPFISRCAVCEA
PAVVIAVHSQTIQIPHCPQGWESLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPF
IECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISRCQVCMKRT
Download sequence
Identical sequences ENSDORP00000011857 ENSDORP00000011857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]