SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011906 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011906
Domain Number 1 Region: 9-173
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-38
Family Ankyrin repeat 0.00065
Further Details:      
 
Domain Number 2 Region: 755-951
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000216
Family Tropomyosin 0.003
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011906
Domain Number - Region: 1027-1132
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0549
Family Myosin rod fragments 0.012
Further Details:      
 
Domain Number - Region: 464-544
Classification Level Classification E-value
Superfamily EsxAB dimer-like 0.0641
Family ESAT-6 like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011906   Gene: ENSDORG00000012662   Transcript: ENSDORT00000012662
Sequence length 1387
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3159:12241:42173:-1 gene:ENSDORG00000012662 transcript:ENSDORT00000012662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAADWNKYDDRLMKAAERGDVEKVSSILAKKGINPGKVDVEGRSAFHVVASKGNLECLNA
ILIHGVDLTASDPAGRNALHLAAKYGHALCLQKLLQYNCPTELVDLQGRTALHDAAMADC
PSSIQLLCDHGASVNAKDIDGRTPLVLDTLMCRPMICQLLIDKGADVNSKDCYHXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRELW
RKGAPLQQWNVKEEINMKSNQRERPSVQELEIENEDLKERLRKIQQEQRILLDKVNGLQL
QLNEEVMVADDLESEREKLKSLLAAKEKQHEESLRTIETLKNRFKYIESDHLGSGSHFSN
RKEDMLLKQSQMYMTDLQGTPPGTAAQVQSRSVLRPLELASPNQTSYSESEILKRELEAM
RTFCDSVKQDRLKLQNELAHKVAECKALALECERVKEDSDEQIKQLEDALKDVQKRMYES
EGKVKQMQTHFLALKEHLTSEAASGHPRAMEELKEQLKDMKVKYEGASTEVGKLRNQMRQ
SERLVEEMRKEEGRLREETAWLQKERSTCRMEQEEAGRKVTEMEGQVKQLQTQLALAVPP
ETFENMKSVLSSEVSEKTKKLAEVEREREKSVSEVRQLKRELESMKAQLAEHVRPEEHEQ
LKRRWEQKSGELGKKVTELTLKNQALQRELERAGVDSQLLSRQVHDLTVEMKNHYVPLKV
SEEMKKSHDVNIDDLNKKLSDATQKYTEKKLETEKLQMENDRLSKHVSRLETVFISPEKH
EKELGALKANLGELKNQLSELNKKCGEDQEKIHTLLSENTSLKKTLNFQYVPVKTHEEVK
SALNSTLEKTKRELSDMKKRFEDINQAFVKVKDENEILKRNLENTQNQMKAEYISLDEHE
AKLKATGQKLKEVQDANAAVLADYKRGQEEILTLHAEIKAQKKELDTIQECIRLKYTPII
SFEECERKFKATEKELKEQLAEQTQKCRVREEEAKKSEQENNRLKKEIVTLQKELKDTHV
LIGNARETERALGRKTEELNKQVKDLSQKYTEVKNEKEKLLEEKAKRTAEILATQNVMQK
QHVPVEQVEALKKSLNSTIENLREEIKSKQRCCEKEQQAVSRLQQQLDNQRNSSVPLAEH
LQVKEAFEKEVGIMKASLREKEEESQNKTAEVSKLQTEVQSTKQALRKLETREVVDLSKY
KATKSDLEAQVSSLNEKLASLNRKYDEVCEEVLHAQKKKLLVREEKESLRCSLEQEIEDQ
KERCDKSLTTISELQRRIHESAQQIEAKDNKITELLNDVERLKQALNGLSQLTYTSSSPS
KRQSQLVDTLQHQVKALQQQLAXXXXXXXXXXXXXXXXXXXXXXGHMDEDVQAALLQIIQ
MRQGLVC
Download sequence
Identical sequences ENSDORP00000011906 ENSDORP00000011906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]