SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012009 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012009
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.22e-36
Family Ankyrin repeat 0.000000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012009   Gene: ENSDORG00000012770   Transcript: ENSDORT00000012769
Sequence length 118
Comment pep:novel scaffold:dipOrd1:scaffold_6157:19611:39815:-1 gene:ENSDORG00000012770 transcript:ENSDORT00000012769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKSVKGPDGLTALEATDNQAIKALLQ
Download sequence
Identical sequences A0A1S3FLD7 A0A250Y9A2
XP_007951981.1.48129 XP_012877140.1.60039 XP_020031857.1.5219 ENSDORP00000012009 ENSDORP00000012009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]