SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012362 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012362
Domain Number 1 Region: 100-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.36e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 156-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 61-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.72e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 5 Region: 253-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000983
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012362   Gene: ENSDORG00000013149   Transcript: ENSDORT00000013148
Sequence length 317
Comment pep:novel scaffold:dipOrd1:scaffold_9909:16171:29702:1 gene:ENSDORG00000013149 transcript:ENSDORT00000013148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEQQAEEEEEEEMQEEMVLLVKGEEEEGEEKYEVVKLKIPVDNKEVPGEMPAPSVDPA
RPHACPDCGRAFARRSTLAKHARTHTGERPFACTECGRCFSQKSALTKHGRTHTGERPYQ
CPECDKRFSAASNLRQHRRRHTGEKPYACADCGRRFAQSSNYAQHLRVHTGEKPYACPDC
GRAFGGSSCLARHRRTHTGERPYACADCGTRFAQSSALAKHRRVHTGEKPHRCAVCGRRF
GHRSNLAEHARTHTGERPYPCAECGRRFRLSSHFIRHRRAHMRRRLYICVGCGRDFKLPV
GATAATATERCPECEGS
Download sequence
Identical sequences ENSDORP00000012362 ENSDORP00000012362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]