SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012400 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012400
Domain Number 1 Region: 305-634
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.29e-71
Family Pancreatic carboxypeptidases 0.00000204
Further Details:      
 
Domain Number 2 Region: 135-287
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.54e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0002
Further Details:      
 
Domain Number 3 Region: 634-664
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000844
Family Carboxypeptidase regulatory domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012400   Gene: ENSDORG00000013185   Transcript: ENSDORT00000013187
Sequence length 717
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4140:81831:180068:-1 gene:ENSDORG00000013185 transcript:ENSDORT00000013187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLAPALALLGWALAGIGVQGAALEDPEDYAQELWSPEPHYERPGPEPQPFSPPLPPG
PGEDQRRLGPPAPEPPEKGSKRRTAPXXXXXXXXXXXXXKNGNRKGRRSKGVEKAASDDY
SVPVAPEDLRECPPLLETLKITDFQLHASTKRYGLEHGRLNIAGINENDFYDGAWCAGRN
DLHQWIEVDARRLTRFTGVITQGRSSLWLSDWVTSYKVMVSNDSHSWVTVKNGSGDMIFE
GNSEKEIPVLNELPVPMVARYIRINPQSWFDNGSICLRMEILGCPLPDPNNYYHRRNEMT
TTDDLDFKHHNYKEMRQLMKVVNEMCPNITRIYNIGKSHQGLKLYAVEISDHPGEHEVGE
PEFHYIAGAHGNEVLGRELLLLLLQFLCQEYLAQNARIVHLVEETRIHILPSLNPDGYEK
ACEGGSELGGWSLGRWTHDGIDINNNFPDLNTLLWEAEDRQNVPRKVPNHYIAIPEWFLS
ENATVAMETRAVISWMEKIPFVLGGNLQGGELVVAYPYDMVRSPWKTQEHTPTPDDHVFR
WLAYSYASTHRLMTDARRRVCHTEDFQKEEGTINGASWHTVAGSLNDFSYLHTNCFELSI
YVGCDKYPHESELPEEWENNRESLIVFMEQVHRGIKGMVRDLHGKGIPNAIISVEGVNHD
IRTASVXGYDMRTRCDFTLSKTNLARIREIMEKFGKQPVSLPARRLKRRGRKRRQRA
Download sequence
Identical sequences ENSDORP00000012400 ENSDORP00000012400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]