SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012408 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012408
Domain Number 1 Region: 61-326
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.46e-49
Family Ankyrin repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 403-446
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000262
Family SOCS box-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012408   Gene: ENSDORG00000013196   Transcript: ENSDORT00000013195
Sequence length 453
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2437:43226:49543:1 gene:ENSDORG00000013196 transcript:ENSDORT00000013195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGETFPFTSSTLRALRLQREWLEWEDRRRAAAQQCRSHRSLSSPRTGLMRPRQSCRDPA
VHNALFSGDLQQVQALFQDEEAANMIVETVNNQLAWSAEQGFWVLTPKTKQTVPLTIAAA
RGYKDCARHLIMQGAQLDSRVGGRTALHEACAQAQLDCVKLLLTFGAKANVLSEEGMTPL
HLCTTPESLQCAKLLLEAGVMVNLAAKESDVTPLHVAAARGLEHHVALYLEHGANVALRT
SQGETALNAACAGAEGPGPGRQHEATARRLLEAGADPRAAGRKQHTPLHNACASGCGGLA
ALLLSHGAHAGARNGAGHTPMDCALQAVQDAPNWEPEVLFAALLDYGAQPVRPEMLKHCA
NFPRALEVLLNAYPCVPSCDTWVEAVLPELWQEHEAFYSSALSMVNQPRRLQHLARLAVR
AQVGSRCRQVVTCLPLPSVLKEYLLLRVEGRIQ
Download sequence
Identical sequences A0A1S3GFE8
XP_012887435.1.60039 ENSDORP00000012408 ENSDORP00000012408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]