SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012440 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012440
Domain Number 1 Region: 23-317
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.08e-54
Family Ankyrin repeat 0.000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012440   Gene: ENSDORG00000013232   Transcript: ENSDORT00000013231
Sequence length 612
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4784:10349:95391:-1 gene:ENSDORG00000013232 transcript:ENSDORT00000013231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRQATMDFSTNSVFDQQKGDSAEDVDLTMVYQAASNGDVNALTAVIREDPSILECCDSE
GCTPLMHAVSGRQVDTVKLLLKMGANINTQDAYGRTSLCLATYLGWLEGCVSLLRNGAKH
NIPDKNGRLPLHAATAEPDVRLLTVLLQQSNLSEVNHQDSEGMTPLHWAAFHNRPQHTQM
LLKKGADPTLVDKDFKTALHWAVQSGNRILCSIILSHHRGPSIINYDDESGKTCVHIAAA
AGFGDIINDLAKVPECNLQALDVDDRTPLHWAAAAGKAECVRSLLELGMDSNLRDINEST
PLAYALYCGHTACVKLLSQESRAEPARSLPSQSNRPPKKEGRFSMLNQIFCKNKKDEQKA
HQKDHSRDRHRGQDTSEVDDIITTFDSIVDTNCQDQPSDQVAMVDFKKRTSENSKYHLSD
KKSLARKGLPPIRTQSLPPITLGNNFLTASQGTTSQAGLSSGAQHTTQRSQKSRSEQDLL
NNRTGCQMLDNSWKGDSNQVFSYKAWTVSSSDKLLDRLLAARPSHQEQPGPPHLPHLTSP
GQNFQHLSPNRPKIRDLPFNRNNLAPLTDQKFLSGEPLRTNRVLPAIPSQRGQGPAAEED
DHTANPTHDTNK
Download sequence
Identical sequences ENSDORP00000012440 ENSDORP00000012440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]