SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012485 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012485
Domain Number 1 Region: 9-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-22
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 2 Region: 357-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.71e-22
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.19e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 484-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-17
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 261-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000661
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 7 Region: 532-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000243
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 190-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000484
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012485
Domain Number - Region: 141-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000865
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012485   Gene: ENSDORG00000013278   Transcript: ENSDORT00000013278
Sequence length 570
Comment pep:novel scaffold:dipOrd1:scaffold_28647:9529:12986:1 gene:ENSDORG00000013278 transcript:ENSDORT00000013278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGLCKEMSQGLVTFRDVALDFSQEEWECLDQSQKDLYKEVMLENYRNLVWLDWECAIN
KLSSKWLTDEEMSLKMVIERLTSHVLEYSSFREAKCEGEFEQPQNQGRSFRQVTTLKDIH
TGKGDSELNTSWRNIPLKLVFLTQQKVPTVKQVHTFDICDKIFSPSSVVVECERLHARKD
SLICNECEGFNQITHFSKDTRSPAGEKHYESKECSNLFSLHVHYPTIHFGKLPHEYDEYG
NAFICYSFLTQPQRILGAKKTNACNDCGKAVSHDLFLSEHQRTYIGEKPYECKECNKAFR
QSIHLAQHQRIHTRVKPFACSVCRKAFSRYAFLVEHQRIHTREKPYECKECNKAFRQAHL
NQHQKIHTGEKPYECNQCGKAFSRHIVLPLHRRIHTGEQPFKCNACGKTFGYCSHFNQHQ
RIHTGEKPYKCIKCGKFFRTDSQLNRHRIHSGEKVLETLICNKPEKTRSGTVAQTRLERV
QAREKLFECSKCGKAFSDALVLIYHKRSHAGEKSYECNRCGKAFSCGSYFSQHQRIHTGE
KPYECNECGNTFSCASALRHHQKIHNREIL
Download sequence
Identical sequences ENSDORP00000012485 ENSDORP00000012485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]