SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012845 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012845
Domain Number 1 Region: 44-171
Classification Level Classification E-value
Superfamily TPR-like 2.53e-17
Family Tetratricopeptide repeat (TPR) 0.004
Further Details:      
 
Domain Number 2 Region: 846-885
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000816
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 768-801
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000235
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 905-932
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000563
Family CCCH zinc finger 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012845
Domain Number - Region: 630-660
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0144
Family CCCH zinc finger 0.0077
Further Details:      
 
Domain Number - Region: 504-532
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0487
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012845   Gene: ENSDORG00000013662   Transcript: ENSDORT00000013662
Sequence length 971
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2311:1499:27489:-1 gene:ENSDORG00000013662 transcript:ENSDORT00000013662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEERRRRQQNITEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYRERDWT
SSISQYTEALNIADYAKSEEILIPKDIIEKLHINRIACYSNMGFHEKVLEDCNAVLSFNS
GNCKALYRKSKALSDLGRYREAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYIR
AELSMKAVPGDEVTKPMSCSVEDIEPDLLTPRQEVLPVVSLPAPAFSHGVGNELASVPMM
PLTSVLPLHVEESALPPTVLANGGKTPFSASEAFLDDGDMVLGDELDDLLDSTPESEDAI
MPSALVRGPLQTASVQSRLPFSTPLLGTLPLGARCAPLPSFAELYPPLTSSLEDFCSSFS
SFAMTEPKPDVSTSTTREGSTLNRSNSSLLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKLMDFTYHATIDHKCKKDILIGRIK
NVEDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDIWTLERKGA
FSREAFFGGNGKINLSVGKLLQEHLGEFIFLCEKCFDHKPRMISKRNKDNSSACSHPDTK
HEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCQREDECFYAHSLVELKV
WTMQSETGISHDAIAQESKQYWQNLEAVGPGAQVFGNQIMPGSLNMKIKFVCAQCLRNGQ
IIEPDKNRKYCSAKAMHSWTKDRRAMRVMSFERKKWMNIRPLPTKKQMPLQFDLCNHIAS
GKKCQYVGNCSFAHSLEEREVWTYMKENGIQDMEQFYELWLKSQKNDKSDDVASQSNKEN
GKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFP
TGYFSICERYMTGTCPDGSGCKFAHGNAELQEWEERRNALKMKLNKARKDHLIAPNDNDF
GKYSFLFKDLN
Download sequence
Identical sequences ENSDORP00000012845 ENSDORP00000012845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]