SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013412 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013412
Domain Number 1 Region: 420-538
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.35e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 32-270,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.28e-31
Family BAR domain 0.024
Further Details:      
 
Domain Number 3 Region: 542-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.54e-30
Family Ankyrin repeat 0.00000233
Further Details:      
 
Domain Number 4 Region: 301-409
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-21
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 931-983
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000643
Family SH3-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013412   Gene: ENSDORG00000014261   Transcript: ENSDORT00000014261
Sequence length 983
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4768:437:151156:1 gene:ENSDORG00000014261 transcript:ENSDORT00000014261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDQISVSEFVAETHEDYMAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
INISGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELTALFKNLIQNMN
NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
VEIVEVTEKERRLFPLQMCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFFQDGLKAVES
LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQMRQSTAYSLHQPQG
NKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNP
EEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT
KEIISEVQKMTGNGVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV
LGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNTRKGYIVAKYIERRYSRKKH
ADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIXXXXXXXXXXX
XXXXXXXXXXXXLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDVDEKLQPSPNRREDRP
VSFYQLGSSQLQPSAGSLARDAANLAKDKPRGFVPSILQNETYGAILSSSPPPSQPTAPS
TTSAPPLPPRNLGKVQTASSSANTLWKTNSVGVGAVSRQRSSSDPPAVHPPLPPLRVTST
NPLSSTPPPPVAKTPGVLEVLSQPSKPTQPGAVQSKPPPLPPQPPSRLPQKKPAPGAEKP
TPLLNKGQPRGLVDLSGTEAPGPLCNAMALQPPAPMPRKSQATKSKPKRVKALYNCVADN
PDELTFSEGDVIVVDGEEDQEWW
Download sequence
Identical sequences ENSDORP00000013412 ENSDORP00000013412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]