SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013444 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013444
Domain Number 1 Region: 365-548
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.29e-27
Family Ankyrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013444   Gene: ENSDORG00000014295   Transcript: ENSDORT00000014294
Sequence length 1007
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_416:97625:161917:1 gene:ENSDORG00000014295 transcript:ENSDORT00000014294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPEYLDLDEIDFSDDISDNRNPGNLRFSLGGPGGTEALGFGSDAEATGLAAGWCPGNE
YSVTSLKTIPELCRRCDSQNEDRPVSSSGWSCGVSTLITNTQKPTGIADIYSKFRPVKRV
SPLKHQPETLENTENDDQKNHKVEHQKGGGPDPPEQLRPDDGGRGLPPGKGADPASAPDE
LEHYDLDMDEILDVPYIKSTQQLASFTKATSEKRILGLCTTINGLPGKACSTGSNENSPP
SAAPLCVLSPVKSPHLRKASAVLLEKHKPSVEESSSSPPLPPCGSACEPESQSKDFLNKS
FSDPPGRKMEKTMTDCQLRSFHLPSSTTEPRLEEQVNGLAWPSSQGSEEKTEHLKKVKSI
LNIVKEGQISLLPHLAADNLDKIHDDSGNNLLHIAASQGHAECLQHLTSLMGEDCLSERN
ADALTPAGLAIKNGQLECVRWMVSETEAIAELSCSKDFPSLIHYAGCYGQEKILLWLLQF
MQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYGANVTMQNHAGEKPSQSAERHGH
TLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQKQLQQLLEAQKSESKSLPSTPS
SPPSPASRTAQWKAADADEESPARSKPAVQEGIQVLGGLSSASRPRPKAKDEDSDKILRQ
LLGKEISENVCTQEKLSLEFQDAQAASKNSKKIPVEKRELKLARLRQLMQRSLSESDTDS
NHSEDPKNTPVRKGDRPRPQPIVESVESVDSSESLHLMIKKHSVASGRRFHFSTKASKSL
DGHSPSPTSESSEPDVESQCPAAGRTPPSQPSGEHPQPSPDSTAAQKVATSPKSALKSPS
SKRRTSQNSKLRVTFEEPLVQMEQTSPELNGEKEKESGRTLQRSSAAGEPGEPLKRPFGT
FRSIMETLSGNQNNNNNYQAAHQLKTSTLPLPSLGRKAPDAKGDPASNASKAKNKAEMYG
SCFSLSSNMLVEEHLRNSARHNDTYREMKKSRSIKHIAEPESKELFL
Download sequence
Identical sequences ENSDORP00000013444 ENSDORP00000013444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]