SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013528 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013528
Domain Number 1 Region: 1658-1902
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-48
Family Ankyrin repeat 0.000000119
Further Details:      
 
Domain Number 2 Region: 986-1127
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 348-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000237
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 4 Region: 684-805
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 5 Region: 115-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 957-1000
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000801
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 839-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000042
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 801-840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000691
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 9 Region: 37-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000094
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 10 Region: 153-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 11 Region: 78-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000343
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 12 Region: 1347-1380
Classification Level Classification E-value
Superfamily Notch domain 0.0000000693
Family Notch domain 0.0035
Further Details:      
 
Domain Number 13 Region: 614-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 494-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 15 Region: 190-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000162
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 16 Region: 878-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000181
Family EGF-type module 0.017
Further Details:      
 
Domain Number 17 Region: 1221-1254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000195
Family EGF-type module 0.015
Further Details:      
 
Domain Number 18 Region: 1125-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000021
Family EGF-type module 0.012
Further Details:      
 
Domain Number 19 Region: 1266-1298
Classification Level Classification E-value
Superfamily Notch domain 0.000000418
Family Notch domain 0.0015
Further Details:      
 
Domain Number 20 Region: 2-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000748
Family EGF-type module 0.013
Further Details:      
 
Domain Number 21 Region: 1306-1338
Classification Level Classification E-value
Superfamily Notch domain 0.00000131
Family Notch domain 0.0049
Further Details:      
 
Domain Number 22 Region: 532-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000136
Family EGF-type module 0.01
Further Details:      
 
Domain Number 23 Region: 386-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000205
Family EGF-type module 0.014
Further Details:      
 
Domain Number 24 Region: 232-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000639
Family EGF-type module 0.023
Further Details:      
 
Domain Number 25 Region: 570-610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family EGF-type module 0.029
Further Details:      
 
Domain Number 26 Region: 930-965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000162
Family EGF-type module 0.033
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013528
Domain Number - Region: 651-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000605
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 1170-1219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0219
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013528   Gene: ENSDORG00000014382   Transcript: ENSDORT00000014385
Sequence length 2041
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_593:7:27701:-1 gene:ENSDORG00000014382 transcript:ENSDORT00000014385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCLSGPCAHGGRCSVGSDGRFLCSCPPGYQGRSCRSDVDECRAGGPCRNGGTCLNTPGSF
RCQCPAGHTGPLCESPALPCAPSPCRNGGTCRQGGDLTYDCACLPGFEGQHCEANVDDCP
GHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHHGGTCFNTLGGHSCV
CVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCH
DDAICDTNPVNGRDICTCPAGFTGGACDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTGTYCEVDIDECQSSPCVNG
GVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXVCEVNIDDCASSPCTFGVCRDGINGYDCVCRPGFTGPLCNVEINECT
SNPCGEGGSCVDGENGFHCLCPPGSLPPLCLPPSHHCAQEPCKHGVCHDVPDGFRCVCEA
GWTGPRCGQSLSPDACESQPCRAGGTCTSEGHGFRCTCPPGVQGRQCEVLSPCTPNPCEH
GGRCEMGPGQLAVCSCPSGWQVRCQQDVDECAGPAPCGPRGICTNLAGSFSCTCLGGYTG
PSCDQDIDDCDPXPCLNGGSCQDGVGSFSCSCLPGFAGSRCARDVDECLSNPCGPGTCTD
HVASFTCTCPPGFGGFHCERDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQFEA
DPCLSRPCLHRGICRASHPGFHCTCLEGFTGSQCQTPIDWCGQAPCQNGGRCVQAGAYCL
CPPGWSGRLCDIRSVPCREAAAQMGVRPEQLCAAGGQCVDQDSSHYCVCPEGRTGSHCEQ
ELDPCLAQPCQNGGTCRVYMGGYVCECPAGYMGDSCETNVDECASRPCQHGGSCIDLVAR
YLCSCPPGTLGVLCEINEDDCGPGAPLDSGTRCLHNGTCVDLVGGFRCNCPPGYTGLHCE
ADINECRPGVCHAAHTRDCLQDPGGHFRCLCHPGFTGPRCQTVLSPCEAQPCQHGGQCRA
SPAPGGGLTFTCHCVQPFWGPRCERVARSCRELQCPTGVPCQLTARGPRCACPPGLPGSS
CRGSRAAASPPGAANATCSGAAPCLHGGSCRPAHTAPFFRCACAPGWAGPRCETPTAAPE
APEEPRCPRAACQAKRGDGRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNS
RCDPACSSPACLYDNFDCRGAGRERACNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLLPPEELLRSGADFLQRLSAILRTSLRFRLDARGQAMVFPYHR
PGPGFEPRARRELVPEVIGSVVMQEINNRLSMQSPEKDKWLKDAQSADYMGTMSTKSLDF
PYTLRDVRGEPLEPPAQGVPTMPLLAASAVFLLIIFVLGVMVARRKREHSTLWFPEGFAL
HKDVAAGHKGRREPVGQDALGMKNMGKGESLMGEVATDWMDTECPEAKRLKVEEAGAGAE
EPVDCRQWTQHHLVAADIRVAPAMALTPPQGDAEADAMDVNVRGPDGFTPLMLASFCGGA
LEQIPAEEEEVDDSSASILSDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLDAG
ADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTSLILAARLAVEGMV
EELIACHADVNAVDELGKSALHWAAAVNNVEAALALLXXXXXXXXXXXXEETPLFLAARE
GSYEVVKLLLDHFANREITDHMDRLPRDVAHERLHQDIVHLLDQPSGPRSPPGPHGLGPL
LCPPGAFLPGLKATPSGAKKSRRPLGKAGLGPQGARGRGKKLSLACPGPLADSSVTLSPV
DSLDSPRPFGGTPASPGGFSLEAPYGAAAATAVSLTQLGGAGRAVMGRQPPGSCVLSLGL
N
Download sequence
Identical sequences ENSDORP00000013528 ENSDORP00000013528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]