SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013538 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013538
Domain Number 1 Region: 63-240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-26
Family Laminin G-like module 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013538   Gene: ENSDORG00000014393   Transcript: ENSDORT00000014397
Sequence length 1601
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3495:73460:130538:-1 gene:ENSDORG00000014393 transcript:ENSDORT00000014397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVSWAPGLWLLSLWATFIHRINAGEQCPPSQPEGLKLEHSSDLSANVTGFNLIRRLNLM
KTSAIKKIRNPKGPLILRLGTASVTQPTRRVFPRSLPEEFALVLTLLLKKHTYQNTWYLF
QVTDAAGYPQISLEVNSQERSLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVA
SVHVDCTSASSQPLGPRRPTRPVGHVFLGLDAEQGKPVSFDLQQAHIYCDPELVLEEGCC
EISPGGCPLESSKSRRDTQSNELIEINPQTEGKVYTRCFCLEEPQSSKVDAQLTGRANQK
AERRAQCPPCAYGAQRSNVTLGPSEPQGGKGERGLPGPSGPKGEKGARGNDCVRISQDAP
LQCAEGPKGEKGEAGGVGPSGLPGSIGQKGQKGEKGDGGLKGLPGKPGRDGRPGEICVIG
PKGQKGDPGFVGPEGLAGEPGPPGLPGPPGIGLPGTPXXXXXXXXXXXXXGSSGIPGKEG
PGGKPGKPGVPGTKGEKGDPCEVCPTLPEGFQNFVGLPGKPGPKGEPGDPASARGDPGIQ
GLKGEKGEPCLSCSTAVGAQHLGPSTGANGDVGSPGLGLPGLPGKAGVPGPRGLKGEKGN
FGEPGPAGSPGPPGQVGPAGIKGAKGEPCEPCSALSRTQDGDSHVVHLPGPVGEKGEPGP
PGFGLPGKQGKAGERGLKGQKGDAGSPGDPGTPGTTGQPGLSGEPGIRGPMGPKGEKGDG
CTACPNLQGALTDMAGLPGKPGPKGEQGPEGVGRPGKPGQPGLPGVQGPPGLKGTQGEPG
PPGRGAQGPQGEPGVQGLPGVQGPPGPQGPPGRTGEKGVQXXXXXXXXXXXXXXXXXXXX
XXXGQDGPQGQTGLPGARGTPGEKGSRGEKGEPGECSCPSRGDPIFSGMPGAPGLWMGSS
SQPGPQGPPGVPGPPGPPGMPGLQGVPGNNGLPGQPGLTAELGSLPIEQHLIKSICGDCA
QGQMAQPASVLMKERGDQIPGVPXXXXXXXCFLERERPRAEEARGDNGEGDPGCPGSPGL
PGPPGVPGQRGEEGPPGMRGSPGLPGPIGPPGFPGAVGSPGLPGLQGERGLTGLTGDKGE
PGPPGQPGYPGAMGPPGLPGIKGERGYTGPAGEKGELGPPGSEGLPGPAGPAGPRGERGP
QGAAGEKGDQGFQGQPGFPGLPXXXXXXXXXXXXXXXXXXXXXGSEGIRGPSGLPGSPGP
PGPPGIQGPAGLDGLDGKDGKPGLRXXXXXXXXXXXXXXXGFKGKTGPGLPGPKGDCGKP
GPPGSSGRPGAEGEPGAMGPQGRPGPPGHVGPAGPPGQPGPAGISALGLKGDRGAPGERG
LAGLPGQPGTPGHPGPPGEPGTDGAAGKEGPPGKQGLYGPPGPKXXXXXXXXXXXXXXXX
XXGMPGGPGKSGSMGPVGPPGPAGERGHPGSPGPAGSPGLPGMPGSMGDMVNYDEIKRYI
RQEIIKMFDERMAYYTSRMQFPMEVAAAPGRPGPPGKDGAPGRPGAPGSPGLPGQIGREG
RQGLPGMRGLPGTKGEKGDTGVGIAGENGLPGPPGPQGPPGYGKMGATGPMGQQGIPGIP
GPPGPTGQPGKAGHCNPSDCFGAMPMEQQYPPMKNMKGPFG
Download sequence
Identical sequences ENSDORP00000013538 ENSDORP00000013538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]