SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013852 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013852
Domain Number 1 Region: 28-164
Classification Level Classification E-value
Superfamily C-type lectin-like 5.23e-23
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 2 Region: 235-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000439
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013852   Gene: ENSDORG00000014724   Transcript: ENSDORT00000014722
Sequence length 608
Comment pep:novel scaffold:dipOrd1:scaffold_41323:6154:8029:1 gene:ENSDORG00000014724 transcript:ENSDORT00000014722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLRLLLARDAAVPALGQAPWTAELRSTCGPGSCYALFPRRRTFLDAWRACRELGGDLAT
PRTPDEARRVDGLVGAGPAGGLLWIGLQRQARQCQPQRPLRGFTWTTGDQDTAFTNWAQP
ASGGPCPAQRCVALEAGGEHRWLEGSCTLAVDGYLCQFGFEGACPALPHEAGQDGPAVYT
TPFHLVSSDFQWLPFGSVAAVQCRAGRGASLLCVKQPAGGVGWSQAGPLCPGPGCGPDNG
GCEHECVEEAAGRVSCRCPEGFRLAADGRGCDDPCAQAPCEQQCEPGGPRGYSCHCRLGF
RPAEDEPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEEDGISCSPAGAMGTRT
SQDLRDELLDDGEEGEEVEEAWEVFDGGWTEEPGILWMESTPPPDFGLPYQPSFPEDREP
RRPYPEPTWPPPLSAPRVPYHSVLSATGPVVVSATRPTRPSARQTPMVPATRPAVPPDQQ
MPRVEAGSPDRHSAHQPRIISSTLPARPPPHQPPLISARYPELAPAPQPPRSPDAQGADT
QTIIHRPPIRVDPVPQDPSRSSHQPPLAPGFPGLRTQPPQLPTISTVQPSLSTISRSLGT
VPHPAASQ
Download sequence
Identical sequences ENSDORP00000013852 ENSDORP00000013852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]