SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013918 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013918
Domain Number 1 Region: 73-217,256-344
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.27e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00062
Further Details:      
 
Domain Number 2 Region: 353-450
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.7e-26
Family Anticodon-binding domain of PheRS 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013918   Gene: ENSDORG00000014796   Transcript: ENSDORT00000014795
Sequence length 451
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3708:3541:278952:1 gene:ENSDORG00000014796 transcript:ENSDORT00000014795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCSALRRVICVYIGLARKASHAYRSYQHQAWGSSKPTAACAAQAASGSVVELLGKSYLQ
DDHSNLSRKVLSRVGKNLHNQQHHPLWLIKERVKEHFYKQYVGRSRTPLFSVYDNLSPVV
TTWQNFDSLLIPADHPSRKKGDNYYLNQTYMLRAHTSAHQWDLLHAGLDAFLVVGDVYRR
DQIDSQHYPVFHQLEGVRLFSKHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLEIRWVDCYFPFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXGAQDRIGWAFGLGLERLAMILYDIPDIRLFWSEDERFLKQFRVSDINQKVKFQPLSKY
PAVTNDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDTFEHPKTLRTSHCYRITYRH
MERTLSQREVSSVHQAVQEAVVQLLGVEGRF
Download sequence
Identical sequences ENSDORP00000013918 ENSDORP00000013918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]