SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014010 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014010
Domain Number 1 Region: 34-311
Classification Level Classification E-value
Superfamily L domain-like 3.15e-51
Family Ngr ectodomain-like 0.0087
Further Details:      
 
Domain Number 2 Region: 410-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000149
Family EGF-type module 0.02
Further Details:      
 
Domain Number 3 Region: 457-541
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000688
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014010   Gene: ENSDORG00000014891   Transcript: ENSDORT00000014891
Sequence length 677
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2489:72766:74799:1 gene:ENSDORG00000014891 transcript:ENSDORT00000014891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRSRLPPPLLLFLLLALEPKVQGCPSGCQCNQPQTVFCTARQGSTVPRDVPPDTVGLY
IFENGITTLDPGSFASLPDLQLLDLSQNQIASLPGSIFQPLVNLSNLDLTANKLREITNE
TFRGLRRLERLYLGKNRIRHIQPGAFDALDHLLELKLQDNELRTLPPLRLPRLLLLDLSH
NSFLALEPGVLDTANVEALRLAGLGLQQLDEGLFGRLRNLHDLDVSDNQLERLPSVIRGL
RGLTRLRLAGNTRIAQLRPEDLAGLAALQELDLSNLSLQALPSDLSHLFPRLRLLAAARN
PFNCVCSLSWFGPWVRENHITLTSPEETRCHFPPKNAGRLLLELDYADFGCPATTTTATV
PTTRTEAGEPTPLPSSPVPTWLSPAAPVTEAPSLPPTALPTTMEPIPRPRDCPVSTCLNG
GTCRLGAAHHLECLCPEGVTGLYCESRVGQAVQPSPTPQATPGPPRPLPLGVEPVSPTSL
RVGLQRYLQGSTVQLRSLRLTYRNLSGPDKRLVTLRLPASLAEYTVTQLQPNATYSICVT
PLGLGRLPGGEEACGEARTPPAVRSNHAPVTQAREGNLPLLIAPALAAVLLAALAAAGAA
YCVRRGRAVAAAAQGKGQVGPGAGPLELEGVKAPLEPGPKATEDSGDALPGGPECEFPLM
GYSGPSLQGAVPAKCYI
Download sequence
Identical sequences A0A1S3ERJ0
ENSDORP00000014010 XP_012867016.1.60039 ENSDORP00000014010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]