SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014161 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014161
Domain Number 1 Region: 244-335,399-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-17
Family SPRY domain 0.035
Further Details:      
 
Domain Number 2 Region: 65-199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000989
Family SPRY domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014161   Gene: ENSDORG00000015045   Transcript: ENSDORT00000015044
Sequence length 442
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1710:18815:35552:-1 gene:ENSDORG00000015045 transcript:ENSDORT00000015044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTRRPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYHG
NSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHA
DDGKLYNGRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPD
GLFPAVGMHSLGEEVRLHLNAELGREDDSIMMVDSYEDEWGRLHDVRVCGTLLEYLGKGK
SIVDVGLAQARHPLSTRSHYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGSVAYHA
DDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVR
NVRNVMYLHQEGEEEEEEEEEEEDGEEIEQEHEGKKVVVFFTRNGKIIGKKDAVVPSGGF
FPTIGMLSCGEKVKVDLHPLSG
Download sequence
Identical sequences ENSDORP00000014161 ENSDORP00000014161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]