SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014343 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014343
Domain Number 1 Region: 339-458
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-36
Family Protein kinases, catalytic subunit 0.00000225
Further Details:      
 
Domain Number 2 Region: 112-227
Classification Level Classification E-value
Superfamily SH2 domain 2.91e-35
Family SH2 domain 0.00000819
Further Details:      
 
Domain Number 3 Region: 71-134
Classification Level Classification E-value
Superfamily SH3-domain 9.55e-19
Family SH3-domain 0.0000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014343   Gene: ENSDORG00000015238   Transcript: ENSDORT00000015237
Sequence length 458
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2:3830:17062:-1 gene:ENSDORG00000015238 transcript:ENSDORT00000015237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVFCKKVESAPKEDVGLEGDFRSYGAADRYGPDPTQARPASSFTHIPNYNNFSPQLTS
PATLVGSTIRGISGAGVTLFVALYDYEARTEDDLTFSKGEKFHILNNNEGDWWEARSLSS
GNSGYIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAYSL
SIRDWDQTRGDHIKHYKIRKLDTGGYYITTRAQFDSVQELVRHYMXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMLEFLKNEEGQVLKLPQLVDM
AAQVAEGMAYMERMNYIHRDLRAANILVGEWLVCKIADFGLARLIEDEEYNPQQGTKFPI
KWTAPEAALYGKFTIKSDVWSYGILLTELISKGRVPYP
Download sequence
Identical sequences ENSDORP00000014343 ENSDORP00000014343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]