SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014578 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014578
Domain Number 1 Region: 2-115
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.24e-39
Family Ankyrin repeat 0.000000922
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014578   Gene: ENSDORG00000015488   Transcript: ENSDORT00000015488
Sequence length 125
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3488:255361:255738:1 gene:ENSDORG00000015488 transcript:ENSDORT00000015488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMKLGNPEIARRLLLKGANPNLKDGTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEG
NLPLHLAAKEGHLPVVEFLVKHTASHVGHRNHKGDTAFDLARLYGRNEVISLMEANGVGG
ATNLQ
Download sequence
Identical sequences ENSDORP00000014578 ENSDORP00000014578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]