SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014681 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014681
Domain Number 1 Region: 246-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 7-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 359-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 460-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-17
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 196-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000165
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014681   Gene: ENSDORG00000015602   Transcript: ENSDORT00000015600
Sequence length 539
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1849:31032:36954:1 gene:ENSDORG00000015602 transcript:ENSDORT00000015600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALLPARELVTFRDVAVLFSRDEWSQLDAAQRRLYREVMLETHSHLLSLGISASTPKV
ICQLRQGEDPSMESEDSRDTCGDFKVEPGKEAHDEGRSGGLLKKEPLQPGGPALPLGRTV
HAAASVAGRERVKRPAPRQQGLRGVGSPGAGARPSSLGSAAPASTPSVPTERIPSLYPAL
GGRALPQALELTGCFQISPRGRPHACRECGQSFSQSAHLLEHQGRLHGGGGGGAGKAHGC
GECGKAFSHRSSLLAHQRVHTGEKPYKCGECGKAFGSSSTLIKHLRVHTGEKPYRCRECG
KAFSQCSTLTVHRRIHTGEKLYKCGECAKAFNCRAKLQRHLRTHTGEKPYRCAECGKGYS
QLPSLAEHQRLHTGERLCPCPQCGRTFTRTAALAEHQRLHAGQKPHQCPECGKTFNQHSS
FNEHRKLHTGEKLYTCGECGKAFGCKSNLYRHQRIHTGEKPYQCRQCGKAFSQYSFLTEH
ERIHTGEKLYKCLECGKAYSYRSNLCRHKKVHTKERLYKWKAYGTPFLYGAALTPYHRF
Download sequence
Identical sequences ENSDORP00000014681 ENSDORP00000014681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]