SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014731 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014731
Domain Number 1 Region: 415-675
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-55
Family YWTD domain 0.0000000212
Further Details:      
 
Domain Number 2 Region: 199-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 3 Region: 78-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 159-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 252-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 6 Region: 285-324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 331-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000553
Family EGF-type module 0.0026
Further Details:      
 
Domain Number 8 Region: 115-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000102
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 9 Region: 367-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000062
Family EGF-type module 0.0015
Further Details:      
 
Domain Number 10 Region: 686-726
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014731   Gene: ENSDORG00000015656   Transcript: ENSDORT00000015656
Sequence length 946
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4499:41130:109994:-1 gene:ENSDORG00000015656 transcript:ENSDORT00000015656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPARGALRPLVMLLFLQHLAAAAAAADPLPDGQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXKKTCADSDFTCDNGHCIPERWKCDGEEECPDGSDEWKATCTRQV
CPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPHEFQCSNRTCLAALFVC
DGDDDCGDGSDERGCAGPACGQHEFRCGGGPCIPERWVCDRQFDCEDGSDEAAELCGRAG
GAGTAAPAACVLTAQFACRSGECIHLGWRCDGDRDCKDKSDEADCPVGACGGDEFQCGDG
TCVLAIKRCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGFRLL
DQKTCGDIDECEDPDACSQICVNYKGYFKCECHPGYEMDALTKNCKAVAGKSPSLIFTNR
HEVRRIDLVKRDYSRLIPMLKNVVALDVEVVTNRIYWCDLSYRKIYSAYMDKASDPAEQE
VLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRCTLFNRDLSEPRAIAVDP
LRGFMYWSDWGYQAKIEKSGLNGVDRQTLVSDNIEWPNGIALDLLNQRLYWVDSKLHQLS
SIDFSGGNRKMLIFSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENL
NNPHDIVIFHELKQPRAADACELSAQPNGGCEYLCLPAPQIFSHSPKYTCACPDTMWLGP
DMKRCYRTPQSTSTTTTTTTTSTPTTTRAVPVTTGAPGTSHGPTSQNHSTTTASPAAAGP
SSVSGPRAPSISLSTPSPATSNHSQHXXXXXXXXXXXXXXXXXXXXXXXXVIALLCMSGY
LIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTTQIGHVYPAAISSFDRPLWAEP
CVGETRELEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKCK
Download sequence
Identical sequences ENSDORP00000014731 ENSDORP00000014731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]