SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014800 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014800
Domain Number 1 Region: 12-208
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-57
Family Prokaryotic proteases 0.000000623
Further Details:      
 
Domain Number 2 Region: 223-319
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-23
Family HtrA-like serine proteases 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014800   Gene: ENSDORG00000015731   Transcript: ENSDORT00000015731
Sequence length 322
Comment pep:novel scaffold:dipOrd1:scaffold_4447:16675:41177:1 gene:ENSDORG00000015731 transcript:ENSDORT00000015731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTN
AHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEF
VVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGE
VIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKEL
KDRHRDFPDVLSGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKKENTL
NMVVRRGNEDIMITVIPEEIDP
Download sequence
Identical sequences ENSDORP00000014800 ENSDORP00000014800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]