SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014883 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014883
Domain Number 1 Region: 325-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000105
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 357-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000707
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014883   Gene: ENSDORG00000015820   Transcript: ENSDORT00000015820
Sequence length 396
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2153:30172:213490:-1 gene:ENSDORG00000015820 transcript:ENSDORT00000015820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENYAKNINTFENRMLMLDGMPAVRVKTELLEYEQGSPNVHNYPDMEAVPLLLNNVKGEPP
EDALPVDHFQTQTEPVDLSINKARTSPTAVSSSPVSMTASASSPSSTSTSSSSSSRPASS
PTVITSVSSASSSSTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHRI
PVVVQSVPVVYTAVRSPGNVNNTIVVPLLEDGRSHGKAQMEPRGLSPRQSKSDSDDDDLP
NVTLDSVNETGSTALSIARAVQEVHPSPVSRVRGNRMNNQKFACSISPFSIESTRRQRRS
ESPDSRKRRIHRCDFEGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTR
HYRKHTGVKPFKCADCDRSFSRSDHLALHRRRHMLV
Download sequence
Identical sequences ENSDORP00000014883 ENSDORP00000014883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]