SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015111 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015111
Domain Number 1 Region: 2-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-53
Family Ankyrin repeat 0.0000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015111   Gene: ENSDORG00000016066   Transcript: ENSDORT00000016066
Sequence length 700
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6163:1385:33680:1 gene:ENSDORG00000016066 transcript:ENSDORT00000016066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKDNSGATVLHLAARFGHPEVVNWLLRHGGGDPAMTTDTGALPIHYAAAKGDFPSLRLIA
QHHPDGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHLCAYDGMSPLHAAAQMGH
CPVIVWLVSCADVSLSEQDKDGATAMHFAASRGHAKVLSWLLLHGGEISADLWGGTPLHD
AAENGELECCQILVVNGAELDVRDRDGYTAADLSDYGHSHCTRYLXXXXXXSVEHRVLSR
DPSTELEARQPDSGMSSPNTTMSVQPTNFDLSSPTSTLSNYDSCSSSHSSIKDRRPPRAL
PGARATDIQSYMDLLNPELGLPQGKKPFPPMFSQPSPTLGSEMPPPPPGYPAPKPPSGVL
AADIYLQTKNKLRHVEKDTFKKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKSFNM
MSPTGDNSELLAEIKAGKSLKPTPQSKGLTTVFSGSGQPASQPDSPQLPVSPTPSRPRSP
TPPFAGSQPVLNGSLVPAPPATPAPGVQLDVEALIPTHDEQGRPIPEWKRQVMVXXXXXX
XXXXXXXXXXEEEEEARLASLPAWRRDLLRKKLEEEREQK
Download sequence
Identical sequences ENSDORP00000015111 ENSDORP00000015111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]