SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015319 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015319
Domain Number 1 Region: 334-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000529
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 367-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000317
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015319   Gene: ENSDORG00000016283   Transcript: ENSDORT00000016282
Sequence length 415
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4697:19942:30554:-1 gene:ENSDORG00000016283 transcript:ENSDORT00000016282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDHLVPVDETFSSERPVGYLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFEACGQELAGPHRSH
LHPGSAGRERGTPPPDGTGVGSAQGPGEGPAPDGPIPVLLQIQPVAVKQEAGADPASPGQ
APENVKVAPLLVSIQGQTFALVPQVVPSSSLSLPSKFVRIAPVPIAAKPIGSGPLGPGPA
GLLVGQKFTKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWR
FSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHVKVHRFPRSSRTVRTLN
Download sequence
Identical sequences ENSDORP00000015319 ENSDORP00000015319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]