SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015408 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015408
Domain Number 1 Region: 61-187
Classification Level Classification E-value
Superfamily Lysozyme-like 9.3e-30
Family C-type lysozyme 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015408   Gene: ENSDORG00000016374   Transcript: ENSDORT00000016375
Sequence length 189
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2235:4539:24563:1 gene:ENSDORG00000016374 transcript:ENSDORT00000016375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQEAPKSCSQAESRVPTDSSKPGARGSTRLPFQFCLRKASEMKAAGVVVLIVCLATVTKS
KIYTRCKLAKIFSRAKLDNYGGFSLGNWICMAYYESHYNTTAQTPLDDGSIDYGIFQINS
FTWCRDAKLQEMNHCHVACPXXXXXXXXXXXXXXXXXXXXXXXXXXXQGWKKHCEGKDLS
EWKKGCEVS
Download sequence
Identical sequences ENSDORP00000015408 ENSDORP00000015408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]