SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015512 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015512
Domain Number 1 Region: 183-238
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000214
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Domain Number 2 Region: 493-685
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000264
Family SPRY domain 0.022
Further Details:      
 
Domain Number 3 Region: 3-42,91-127
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000652
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015512
Domain Number - Region: 128-178
Classification Level Classification E-value
Superfamily RING/U-box 0.0459
Family ZZ domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015512   Gene: ENSDORG00000016487   Transcript: ENSDORT00000016487
Sequence length 694
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4032:3346:15754:-1 gene:ENSDORG00000016487 transcript:ENSDORT00000016487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIKNIERELICPACKELFSHPLILPCQHSVCHKCVKELLLSSIDDSFNDVASDVSNQSSP
RLRLPSPSIDRIDRVSRPGWKRSSLPSQSIAFPCPGCGHDVDLGERGISGLFRNFTLESI
VERYRQAARAATAIMCDLCKPPPQESTKSCVDCSASYCNECFKIHHPWGTLKAQHEYVGP
TTNFRPKVLMCPEHETEKINMYCELCRRPVCHLCKLGGVHSNHRVTTMSSAYKTLKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXFSFLFDEKCGYNAEHLLLNLKRDRVESRAGLATLLEAERIQTGHHASLD
YIVADAGIAKGRHFWAFRVEPYSYLVKVGVASLDKLQEWLHSPYEQDSGHDSGSEEAGPE
APQPFTLVTVGMRKLFVPRAGAACGAPEARVLPMPASIGVCLDHDRGRVAFYDAARMRCL
CERPVDRAHTLFPAFALLGGAGVQLEEPIAPRCL
Download sequence
Identical sequences ENSDORP00000015512 ENSDORP00000015512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]