SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015521 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015521
Domain Number 1 Region: 828-880
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000389
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 975-1026
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000711
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 3 Region: 1067-1120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000557
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 4 Region: 804-837
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000121
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015521
Domain Number - Region: 947-986
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000109
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 732-783
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000356
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 1125-1154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00251
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 1044-1077
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00355
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015521   Gene: ENSDORG00000016495   Transcript: ENSDORT00000016497
Sequence length 1173
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6004:5655:31068:1 gene:ENSDORG00000016495 transcript:ENSDORT00000016497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPNYSQQLLLQLYTLCKEQQFCDCTVSIGTIYXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIRCFNGEGGCPAFQRLLDXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTEEGKTLSVLLLEHKEDL
IQSITQLRPIVEFLETAKEEFLPGSQKRVILNCCQGKTPKEAIENWLHTMTEEKTLTAES
LVKVLQAVKTTLPNLGLLLENLQKLAPLSSAPXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVMEKLVERDSDSGGFSSLMSAALEKQTLSATAIWQLLLAARE
TKTCPLNLLLEQIGREPGANAFFQAVTTPESAALKAILKHSRLIMDAIQQRTVLQHFSSE
EKHLVETLKEILSISSETASLEAVLSRAMEKSVSAIEICRLLCSVHRSFPGLQPVMQELA
CIGFLTKENGEREMWRLSDKFHHEASNKENEKAAEVTGEGCQPTEQKEKEETGSPPEQQE
KDTSASPDSAKKSFVCKACDKSFHFYCRLKVHMKRCRVAKSKQVQCKDCSETKDSKKELE
KHQLEAHGMGGEPDIPKKKKKRLPVTCDLCGREFAHASGMQYHKLTEHFDEKPFSCEECG
AKFAANSTLKNHLRLHTGDRPFMCKHCLMTFTQASALAYHTKKKHSEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEDPYDCKKCRMSFPTL
QDHRKHIHEVHSKEYHPCPTCGKIFSAPSMLERHMVTHVGGKPFSCGICNKAYQQLSGLW
YHNRTHHPDVFAAQNHRSSKFSSLQCSSCDKTFSSMMEHKAHIKAEHADLKFHECDQCKE
LFPTLALLQVHVKCQHSGSQPFRCLYCAATFRFPGALQHHVTMEHFKQSESTFPCELCGE
LFTSQAQLDSHVESEHPKVTGTDTQAAASQVVQ
Download sequence
Identical sequences ENSDORP00000015521 ENSDORP00000015521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]