SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015616 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015616
Domain Number 1 Region: 5-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000623
Family APC10-like 0.03
Further Details:      
 
Domain Number 2 Region: 436-600
Classification Level Classification E-value
Superfamily ARM repeat 0.0000912
Family PBS lyase HEAT-like repeat 0.087
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015616
Domain Number - Region: 203-254
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.0628
Family YmcA-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015616   Gene: ENSDORG00000016599   Transcript: ENSDORT00000016600
Sequence length 913
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4519:36997:62106:-1 gene:ENSDORG00000016599 transcript:ENSDORT00000016600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQ
LLAHQYMIASKIEFYISESLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDA
VGQFLKLIFHENHVNKYNIYNQVALVAINIIGDPADFGDKNNITSREKVIDHYLGHNPED
PALXXXXXXRSDYISPLDDLAFDMYQDPEVAQIIRRLDERKREAVQKERYDHAKKLKQAI
ADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMARYRAQVYEQLELHGLLQGEPETR
RPFALPLQPLAHPGSPRHQKPVPSPPQPEEAVPENLPADPFLQEKLSSHPLETLPRCFAA
DPSPPAAGPLPRNPVETLPYDERPLPASRKPQGDTSGEPEISQADSRGAQRGGGTVEPEP
LTEKALREASSAIDVLGETLVAGAYSKTWSCREDALLALSKRLMELPIGTPKEDLKNTLR
ASVFLIRRAMKDIVISVFQASLKLLKMIITQYIPKHKLSKVETTHCVERTLPALLTRTGD
SSARLRVMASNFIQEMALFKEVRCLQIIPPSLVQPLRANTSVHLAMSQVDLLARLLRDLG
TENSGFTVDNVMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXAQKRAATEEAEKQKKEEIKVLQGQLAALKEIQAEVQPQ
GRRVAPPAAPDAPDDHYLDNLCIFCGERSESFTEEGLDLHYWKHCLMLTRCGHCRQVVEI
SSLTEHLLTECDKREEFGKCHRCSEAVPKEELPRHIKAKECNPAKSEKLANRCPLCHENF
TPGEEAWKAHLMSPAGCTMNLRKTHILHKGPVPAQGKGPTAARSCPSVAKIGSKIPTPKG
GLSKSSRRTHTQR
Download sequence
Identical sequences ENSDORP00000015616 ENSDORP00000015616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]